Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1041) | |||||
---|---|---|---|---|---|
DME Name | NADH dehydrogenase (nuoE), Streptomyces griseus | ||||
Synonyms | DPNH-menadione reductase; FMN-dependent NADH-quinone reductase; D-diaphorase; Reduced nicotinamide adenine dinucleotide (quinone); FMN-dependent NADH:quinone oxidoreductase; H+(NA+)-translocating NADH-quinone oxidoreductase; NADH-dependent 1,4-benzoquinone reductase; NADH-Q oxidoreductase; NADH dehydrogenase subunit E; nuoE | ||||
Gene Name | nuoE | ||||
UniProt ID | |||||
EC Number | EC: 1.6.5.11 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Streptomyces griseus (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MTDGQTSLGMPQLPAPDYPAEVRARLEADAEEIIARYPGSRSALLPLLHLVQSEEGHVTR
TGMKFCAEILGLTTAEVTAVATFYTMYRRKPSGDYQVGVCTNTLCAVMGGDAIFEELKEH LGVGNNETTEDGKVTLEHIECNAACDFAPVVMVNWEFFDNQTPDSAKKIVDDLRAGRPVE PTRGAPLCTYKETARILAGFPDEREGAVEATGGAGPASLVGLRLAKGETPHHKIVHPRGE SASGEGE |
||||
Function | This enzyme is inhibited by AMP and 2,4-dinitrophenol but not by dicoumarol or folic acid derivatives. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Doxorubicin |
Drug Info | Approved | Breast cancer | ICD11: 2C60 | [1] |
References | |||||
---|---|---|---|---|---|
1 | Bacterial inactivation of the anticancer drug doxorubicin. Chem Biol. 2012 Oct 26;19(10):1255-64. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.