Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME1050)
DME Name Dihydrofolate reductase (folA), Lactobacillus casei
Synonyms DHF reductase; 5,6,7,8-tetrahydrofolate: NADP+ oxidoreductase; Bifunctional TS-DHFR; BmDHFR; Bacterial DFR-TS; Bacterial DHFR; TC_0902; folA
Gene Name folA
UniProt ID
DYR_LACCA
EC Number    EC: 1.5.1.3     (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
CH-NH donor oxidoreductase
NAD/NADP acceptor oxidoreductase
EC: 1.5.1.3
Lineage    Species: Lactobacillus casei     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Bacteria
Phylum: Firmicutes
Class: Bacilli
Order: Lactobacillales
Family: Lactobacillaceae
Genus: Lactobacillus
Species: Lactobacillus casei
Interactome
(loading-time for this interactome depdends on the speed of web connection)
       Interactions between Xenobiotics and DME (XEOTIC)                      
Jump to Detailed Interactome Data                      
       Interactions between Host Protein and DME (HOSPPI)                     
Jump to Detailed Interactome Data                      
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Tissue Distribution Primarily distributed in human gut.
Sequence
MTAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTN
VVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLA
GSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
Structure
1AO8 ; 1BZF ; 1DIS ; 1DIU ; 1LUD ; 2HM9 ; 2HQP ; 2L28 ; 2LF1 ; 3DFR
Function This enzyme is key enzyme in folate metabolism and can catalyze an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis. And it also slowly reduces folate to 5,6,7,8-tetrahydrofolate.
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:          1 Drugs
Folic acid
 Drug Info Approved Vitamin deficiency ICD11: 5B55 [1]
References
1 Molecular cloning of the gene for dihydrofolate reductase from Lactobacillus casei. Gene. 1982 Feb;17(2):229-33.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.