Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1178) | |||||
---|---|---|---|---|---|
DME Name | Inositol dehydrogenase (idh), Lactobacillus casei | ||||
Synonyms | Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase; Myo-inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase; MI 2-dehydrogenase/DCI 3-dehydrogenase; iolG | ||||
Gene Name | iolG | ||||
UniProt ID | |||||
EC Number | EC: 1.1.1.18 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Lactobacillus casei (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MVVKVGVIGTGAMGRAHIDRLTNVLTGAEVVAVTDIDHEAAEAAVRDFHLNAKVYPDDTS
LLQDPDIDAVFVVSFGGAHEATVLKALDTDKFIFTEKPLATTLEGAKRIVDKELTKSKKV IQVGFMRRYDQGIRALKEKLDTGIIGAPLVVRASHINPNVASNYSNEMAITDTLIHEIDE MHWLLDDEYTSIQITYPRQSAEVRNEGLHDPQLATLTTKKGTVIQVLVHVTAQYGYEVKL EVIGETGELQLPNYGLGPILRSNANQQTAVEMSWINRFIQAYNTEVQEFIDQVAKSEPPV GPSAWDGYIAAITAAAANRSQKDQETVLINVAGTPTFYQNKNAIHA |
||||
Function | This enzyme involves in the oxidation of myo-inositol and D-chiro-inositol to 2-keto-myo-inositol and 1-keto-D-chiro-inositol, respectively. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs in Phase 4 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Inositol |
Drug Info | Phase 4 | Polycystic ovary syndrome | ICD11: 5A80 | [1] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.