Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1189) | |||||
---|---|---|---|---|---|
DME Name | Beta-hydroxysteroid dehydrogenase (hdhB), Collinsella aerofaciens | ||||
Synonyms | Oxidoreductase short chain dehydrogenase/reductase family protein; COLAER_02088 | ||||
Gene Name | hdhB | ||||
UniProt ID | |||||
Gene ID | |||||
EC Number | EC: 1.1.1.201 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Collinsella aerofaciens (Click to Show/Hide the Complete Species Lineage) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MNLREKYGEWGLILGATEGVGKAFCEKIAAGGMNVVMVGRREEKLNVLAGEIRETYGVET
KVVRADFSQPGAAETVFAATEGLDMGFMSYVACLHSFGKIQDTPWEKHEAMINVNVVTFL KCFHHYMRIFAAQDRGAVINVSSMTGISSSPWNGQYGAGKAFILKMTEAVACECEGTGVD VEVITLGTTLTPSLLSNLPGGPQGEAVMKIALTPEECVDEAFEKLGKELSVIAGQRNKDS VHDWKANHTEDEYIRYMGSFYRD |
||||
Structure | |||||
Function | This enzyme catalyzes the oxidation of the 7beta-hydroxy group of bile acids such as ursodeoxycholate. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Ursodeoxycholic acid |
Drug Info | Approved | Hepatic fibrosis/cirrhosis | ICD11: DB93 | [1] |
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Dehydrocholic acid |
Drug Info | Investigative | Asthma | ICD11: CA23 | [1] |
Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||||||||||||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.