Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1200) | |||||
---|---|---|---|---|---|
DME Name | L,D-carboxypeptidase A (ldcA), Escherichia coli | ||||
Synonyms | Carboxypeptidase; LD-carboxypeptidase; Murein tetrapeptide carboxypeptidase; AC789_1c12840; ACN002_1829; ACU90_08670; AM270_04255; AMK83_26425; BANRA_01764; BB545_18240; BN17_10381; BON69_25620; BON71_20135; BON72_24745; BON76_11630; BON94_22610; BON95_19240; BVL39_22290; BvCms28BK_02847; BvCmsNSNP036_02737; BvCmsNSP006_02167; BvCmsOUP014_03493; BvCmsSIP019_04003; BvCmsSIP044_03891; C6669_23480; C7235_14540; C7B02_00395; C9114_05805; C9162_18910; C9Z28_09785; C9Z37_17470; COD46_20425; CR538_15200; CRD98_02440; CWS33_11925; D2184_25220; D6T60_03840; D9K48_17225; DEN89_04765; DEO04_08505; DL545_14375; DQF57_19545; DS732_10945; DXT69_15460; E0I42_05850; EHH55_11410; EJC75_04705; ERS085374_03985; ERS085379_03097; EXX24_08925; EXX78_01285; EYY78_23060; F0312_19185; F1E03_16650; F1E13_06740; F7F29_12315; FQ915_22760; FQR64_13480; HW43_09665; HmCmsJML079_01442; NCTC8009_03749; NCTC8179_03095; NCTC8622_05704; NCTC9055_04762; NCTC9111_02948; NCTC9703_02151; RG28_17325; RX35_02911; SAMEA3472043_03661; SAMEA3472055_01267; SAMEA3472070_03304; SAMEA3472114_00072; SAMEA3752553_01826; SAMEA3753064_00071; SAMEA3753290_01164; UN86_12510; b1192; ldcA | ||||
Gene Name | b1192 | ||||
UniProt ID | |||||
EC Number | EC: 3.4.17.13 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Escherichia coli (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MSLFHLIAPSGYCIKQHAALRGIHRLTDEGHQVNNVEVIARRCERFAGTETERLEDLNSL
ARLTTPNTIVLAVRGGYGASRLLADIDWQALVARQQHDPLLICGHSDFTAIQCGLLAQGN VITFSGPMLVANFGADELNAFTEHHFWLALRNKTFTIEWQGEGPTCQTEGTLWGGNLAML ISLIGTPWMPKIENGILVLEDINEHPFRVERMLLQLYHAGILPRQKAIILGSFSGSTPND YDAGYNLESVYAFLRSRLSIPLITGLDFGHEQRTVTLPLGAHAILNNTREGTQLTISGHP VLKM |
||||
Function | This enzyme hydrolyzes peptide bonds of C-terminal residues with aromatic or aliphatic side-chains. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Dithiazoline |
Drug Info | Investigative | Gonococcal infection | ICD11: 1A70 | [1] |
References | |||||
---|---|---|---|---|---|
1 | Selective inhibition of Neisseria gonorrhoeae by a dithiazoline in mixed infections with Lactobacillus gasseri. Antimicrob Agents Chemother. 2018 Nov 26;62(12). pii: e00826-18. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.