Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1322) | |||||
---|---|---|---|---|---|
DME Name | Azoreductase (azoR), Lactobacillus buchneri | ||||
Synonyms | Azo-dye reductase; FMN-dependent NADH-azo compound oxidoreductase; FMN-dependent NADH-azoreductase; azoR; DCW31_09905 | ||||
Gene Name | azoR | ||||
UniProt ID | |||||
EC Number | EC: 1.7.1.6 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Lactobacillus buchneri (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MAKILVIKAHPLTIEHSRTLKILDAFMTQYKVSNPEDTIETRDLYAEEFPDIDRSMMTAW
GQLQNGVGFPDLTTQQQQQLSAYDSTTQQYIDADKVILANPMWNLSIPAKLQAWIDTICV AGKTFQYTETAEIPLVPGKKVLHIQTAGGFYDGKDFGAKYISGIMHFLGASDVQELAVEG MDHFPEKAEAFMQDGLERATALATKF |
||||
Function | This enzyme catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. And it requires NADH, but not NADPH, as an electron donor for its activity. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Sulfasalazine |
Drug Info | Approved | Rheumatoid arthritis | ICD11: FA20 | [1] |
References | |||||
---|---|---|---|---|---|
1 | The role of intestinal bacteria in the metabolism of salicylazosulfapyridine. J Pharmacol Exp Ther. 1972 Jun;181(3):555-62. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.