Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1336) | |||||
---|---|---|---|---|---|
DME Name | Beta-lactamase (blaB), Clostridium hiranonis | ||||
Synonyms | Penicillinase; Cephalosporinase; Beta-lactam; blaR1_1; CLOBL_05120 | ||||
Gene Name | blaR1_1 | ||||
UniProt ID | |||||
EC Number | EC: 3.5.2.6 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Clostridium hiranonis (Click to Show/Hide the Complete Species Lineage) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MFKKLVFLGILLLPLILWIIWSNTSKNSSNSSMIYVEKNNENSEKVLNEDLSKYFSGYDG
CFVLYDKNENKYLIYNEAKSEKEISPCSTFKIVNALIGLDTNVLQDENTIFKWNGTKYAI EEWNKDQTLSSAVANSVVWYFQDVASKVGEERMQEYLSKIDYGNKDISGGLTKFWLQSSL KISPMQQVEILRNMYDYKLPFSRRNIDIVKKVLKISEQNGIVLSGKTGSGTDGNKSINGW FIGYVESDNDVFFLAVNIEGKDNATGVLAEQIAKNILKDKNIL |
||||
Function | This enzyme hydrolyzes beta-lactam. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Ceftiofur |
Drug Info | Investigative | Superficial thrombophlebitis | ICD11: BD70 | [1] |
References | |||||
---|---|---|---|---|---|
1 | Bovine intestinal bacteria inactivate and degrade ceftiofur and ceftriaxone with multiple beta-lactamases. Antimicrob Agents Chemother. 2011 Nov;55(11):4990-8. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.