Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME1340)
DME Name Nitroreductase (NTR), Bacteroides fragilis
Synonyms FMN reductase (NAD(P)H); FMN reductase NADPH; nfrA2; CQW34_03043; HMPREF1018_03053
Gene Name nfrA2
UniProt ID
A0A1C0X0J8_BACFG
EC Number    EC: 1.5.1.39     (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
CH-NH donor oxidoreductase
NAD/NADP acceptor oxidoreductase
EC: 1.5.1.39
Lineage    Species: Bacteroides fragilis     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Bacteria
Phylum: Bacteroidetes
Class: Bacteroidia
Order: Bacteroidales
Family: Bacteroidaceae
Genus: Bacteroides
Species: Bacteroides fragilis
Interactome
(loading-time for this interactome depdends on the speed of web connection)
       Interactions between Host Protein and DME (HOSPPI)                     
Jump to Detailed Interactome Data                      
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Tissue Distribution Primarily distributed in human gut.
Sequence
MIILFISLQKKDMMDTVKNRRTIRKYQQKDITPDLLNDLLETSFRASTMGGMQLYSVVVT
RDAEKKEILSPAHFNQPMVKEAPVVLTFCADFRRFCKYCQERNAVPGYGNLMSFLNAAMD
TLLVAQTFCTLAEEAGLGICYLGTTTYNPQMIIDALHLPELVFPITTVTVGYPAESPKQV
DRLPIEGIIHEESYHDYTAEDINRLYAYKESLPENKLFIEENQKETLAQVFTDVRYTKKD
NEFMSENLLKVLRRQGFMD
Function This enzyme contains FMN and can utilize NADH and NADPH with similar reaction rates. It also reduces riboflavin and FAD, but more slowly.
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:          1 Drugs
Metronidazole
 Drug Info Approved Amebiasis ICD11: 1A36 [1], [2]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR004362 Nitrobenzaldehyde 4-aminobenzaldehyde Reduction - Reduction Nitrobenzaldehyde [3]
MR003795 Nitrofural Nitrofural cyano-metabolite Unclear - Unclear Nitrofural [4]
References
1 Isolation of metronidazole-resistant Bacteroides fragilis carrying the nimA nitroreductase gene from a patient in Washington State. J Clin Microbiol. 2004 Sep;42(9):4127-9. Case Reports
2 Biotransformation of 1-nitropyrene in intestinal anaerobic bacteria. Microbiol Immunol. 1982;26(11):993-1005.
3 ElNFS1, a nitroreductase gene from Enterobacter ludwigii, confers enhanced detoxification and phytoremediation of 4-nitrobenzaldehyde in rice
4 Cyano metabolite as a biomarker of nitrofurazone in channel catfish

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.