Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1586) | |||||
---|---|---|---|---|---|
DME Name | Oxygen-insensitive NADPH nitroreductase A (nfsA), Pseudomonas putida | ||||
Synonyms | Oxygen-insensitive NAD(P)H nitroreductase A; Modulator of drug activity A; nfsA; pnrA | ||||
Gene Name | pnrA | ||||
UniProt ID | |||||
EC Number | EC: 1.5.1.38 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Pseudomonas putida (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human skin. | ||||
Sequence |
MSLQDEALKAWQARYGEPANLPAADTVIAQMLQHRSVRAYSDLPVDEQMLSWAIAAAQSA
STSSNLQAWSVLAVRDRERLARLARLSGNQRHVEQAPLFLVWLVDWSRLRRLARTLQAPT AGIDYLESYTVGVVDAALAAQNAALAFEAQGLGIVYIGGMRNHPEAMSEELGLPNDTFAV FGMCVGHPDPAQPAEIKPRLAQSVVLHRERYEATEAEAVSVAAYDRRMSDFQHRQQRENR SWSSQAVERVKGADSLSGRHRLRDALNTLGFGLR |
||||
Function | This enzyme can catalyze FMN and also can catalyze FAD and riboflavin with lower activity. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Nitrobenzoate |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1], [2] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.