Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1694) | |||||
---|---|---|---|---|---|
DME Name | Xylose isomerase (xylA), Alistipes indistinctus | ||||
Synonyms | Xylose isomerase xylA; Isomerase xylA; Enzyme xylA; xylA; DEB64_01060 | ||||
Gene Name | xylA | ||||
UniProt ID | |||||
EC Number | EC: 5.3.1.5 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Alistipes indistinctus (Click to Show/Hide the Complete Species Lineage) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MAKQYFPTVGKIAFEGTSSKNPMAFRYYEPERVVKGRKMKDWLRFSMAWWHTLCAEGADQ
FGGGTKQFAWNEAACPIERAKAKMDAGFEFMQKMGIEYYCFHDVDLVDEDPDPVKYEQNL REIVAYAKQKQAETGIKLLWGTANVFGNARYMNGASTNPDFDTAARAMLQIKNAIDATIE LGGENYVFWGGREGYMSLLNTDMKREKEHMATMLTMARDYARSKGFKGNFLIEPKPMEPM KHQYDVDTETVIGFLRAHGLDKDFKVNIEVNHATLAGHTFEHELQCAVDAGMLGSIDANR GDYQNGWDTDQFPIDLYEMVQAMMVIVRGGGLQGGGTNFDAKTRRNSTDPEDLFIAHIAA MDVMARALLIAADLLDNSPYQKMLAERYASYDKGEGKAFEEGKLTLEQVADYARTHEPVQ HSGKQELYEAILNMYM |
||||
Function | This enzyme catalyzes the interconversion of aldose and ketose sugars with broad substrate specificity. It binds the closed form of its sugar substrate (in the case of glucose, only the alpha anomer) and catalyses ring opening to generate a form of open-chain conformation that is coordinated to one of the metal sites. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Xylose |
Drug Info | Approved | Malabsorption syndrome | ICD11: DA96 | [1] |
References | |||||
---|---|---|---|---|---|
1 | Bacterial xylose isomerases from the mammal gut Bacteroidetes cluster function in Saccharomyces cerevisiae for effective xylose fermentation. Microb Cell Fact. 2015 May 17;14:70. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.