Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1732) | |||||
---|---|---|---|---|---|
DME Name | New delhi metallo-beta-lactamase NDM-1 (blaNDM), Salmonella enterica | ||||
Synonyms | Metallo-beta-lactamase new delhi NDM-1; Metallo-beta-lactamase new delhi NDM1; blaNDM; NDM1 | ||||
Gene Name | blaNDM | ||||
UniProt ID | |||||
EC Number | EC: 3.5.2.6 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Salmonella enterica (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MELPNIMHPVAKLSTALAAALMLSGCMPGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQ
HTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTH AHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPL KVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAF PKASMIVMSHSAPDSRAAITHTARMADKLR |
||||
Function | This enzyme hydrolyzes beta-lactam. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 2 Drugs | ||||
Amoxicillin |
Drug Info | Approved | Acute otitis media | ICD11: AB00 | [1] |
Meropenem |
Drug Info | Approved | Pseudomonas infection | ICD11: 1G40 | [1] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.