Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1746) | |||||
---|---|---|---|---|---|
DME Name | Cytochrome P450 101B1 (cyp101), Novosphingobium aromaticivorans | ||||
Synonyms | Cytochrome P450 family 101 subfamily B member 1; Cytochrome P450-cam B1, Cytochrome P450cam B1; P450 101B1; cyp101B1 | ||||
Gene Name | cyp101 | ||||
UniProt ID | |||||
EC Number | EC: 1.14.15.1 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Novosphingobium aromaticivorans (Click to Show/Hide the Complete Species Lineage) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MIPAHVPADRVVDFDIFNPPGVEQDYFAAWKTLLDGPGLVWSTANGGHWIAARGDVVREL
WGDAERLSSQCLAVTPGLGKVMQFIPLQQDGAEHKAFRTPVMKGLASRFVVALEPKVQAV ARKLMESLRPRGSCDFVSDFAEILPLNIFLTLIDVPLEDRPRLRQLGVQLTRPDGSMTVE QLKQAADDYLWPFIEKRMAQPGDDLFSRILSEPVGGRPWTVDEARRMCRNLLFGGLDTVA AMIGMVALHLARHPEDQRLLRERPDLIPAAADELMRRYPTVAVSRNAVADVDADGVTIRK GDLVYLPSVLHNLDPASFEAPEEVRFDRGLAPIRHTTMGVGAHRCVGAGLARMEVIVFLR EWLGGMPEFALAPDKAVTMKGGNVGACTALPLVWRA |
||||
Structure | |||||
Function | This enzyme is a P-450 heme-thiolate protein, and it also acts on (-)-camphor and 1,2-campholide, forming 5-exo-hydroxy-1,2-campholide. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Beta-ionone |
Drug Info | Investigative | Breast cancer | ICD11: 2C60 | [1], [2] |
Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.