Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1775) | |||||
---|---|---|---|---|---|
DME Name | Glycosyltransferase (Gtf), Actinomyces howellii | ||||
Synonyms | Archaeal glycosylation protein; Glycosyltransferase/acyltransferase penicillin-binding protein; C3V41_10425; GTF | ||||
Gene Name | C3V41_10425 | ||||
UniProt ID | |||||
EC Number | EC: 2.4.1.155 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Actinomyces howellii (Click to Show/Hide the Complete Species Lineage) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human oral cavity. | ||||
Sequence |
MPEPQEVPALTPSASVIVPSYRGEARLPVLLGGLAQQDTTDFEVVVVIDGEVDASAAVLA
GLGESTGLDLDVIVFPRNRGRVAALNAGHAAARGEVLIRCDDDLLPAPDFVSGHVARHAH HGPRGVVALANDVMPDSPYARAYGVRSMDHLIASAYAGDIEPWRLWSANCSLTRGTWEQV GEYSQEYAHYGMEDTDYGYRLHQAGIPLVIAPELQVAHLGAPTSTHDRVMRAFHSGASRR TFEARHGSALSLPSAGTGPWGRLVDGLSRAGDEPRYERATRAVDRLLPYVPRYVAEKLVA LCVESASLAGYRHAQDVTASF |
||||
Function | This enzyme requires Mg2+ and it catalyses the addition of N-acetylglucosamine in beta 1-6 linkage to the alpha-linked mannose of biantennary N-linked oligosaccharides, and thus enables the synthesis of tri- and tetra-antennary complexes. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 2 Drugs | ||||
Q-44287045 |
Drug Info | Preclinical | Colon cancer | ICD11: 2B90 | [1] |
Macrolactin A |
Drug Info | Preclinical | Colon cancer | ICD11: 2B90 | [1] |
References | |||||
---|---|---|---|---|---|
1 | A bacterial glycosyltransferase gene toolbox: generation and applications. Phytochemistry. 2009 Oct-Nov;70(15-16):1812-21. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.