Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1873) | |||||
---|---|---|---|---|---|
DME Name | Azoreductase (azoR), Fusobacterium nucleatum | ||||
Synonyms | Azo-dye reductase; FMN-dependent NADH-azo compound oxidoreductase; FMN-dependent NADH-azoreductase; azoR; JW1409; acpD; b1412 | ||||
Gene Name | azoR | ||||
UniProt ID | |||||
Gene ID | |||||
EC Number | EC: 1.7.1.6 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Fusobacterium nucleatum (Click to Show/Hide the Complete Species Lineage) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MSKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALR
PSDAPLTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFR YTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYG PEMAAKAQSDAKAAIDSIVSA |
||||
Structure | |||||
Function | This enzyme catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs in Phase 2 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
CTK0H-9987 |
Drug Info | Phase 2 | Trachoma | ICD11: 1C23 | [1] |
References | |||||
---|---|---|---|---|---|
1 | Developing a metagenomic view of xenobiotic metabolism. Pharmacol Res. 2013 Mar;69(1):21-31. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.