Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME1881)
DME Name Metallo-beta-lactamase (blaM), Klebsiella pneumoniae
Synonyms Metallo-beta-lactamase NDM-1; New Delhi metallo-beta-lactamase-1; Metallo-beta-lactamase type 2c; Metallo-beta-lactamase type IIc; B2 metallo-beta-lactamase; Beta-lactamase type IIc; NDM-1; blaNDM-1
Gene Name blaNDM-1
UniProt ID
BLAN1_KLEPN
Gene ID
11934636
EC Number    EC: 3.5.2.6     (Click to Show/Hide the Complete EC Tree)
Hydrolases
Carbon-nitrogen hydrolase
Cyclic amide hydrolase
EC: 3.5.2.6
Lineage    Species: Klebsiella pneumoniae     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Bacteria
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Klebsiella
Species: Klebsiella pneumoniae
Subspecies: Klebsiella pneumoniae KUN5033
Interactome
(loading-time for this interactome depdends on the speed of web connection)
       Interactions between Xenobiotics and DME (XEOTIC)                      
Jump to Detailed Interactome Data                      
       Interactions between Host Protein and DME (HOSPPI)                     
Jump to Detailed Interactome Data                      
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Tissue Distribution Primarily distributed in human gut.
Sequence
MELPNIMHPVAKLSTALAAALMLSGCMPGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQ
HTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTH
AHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPL
KVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAF
PKASMIVMSHSAPDSRAAITHTARMADKLR
Structure
3PG4 ; 3RKJ ; 3RKK ; 3SBL ; 3SFP ; 3SPU ; A/B/C/D/E=27-270 ; 3SRX ; 3ZR9 ; 4EXS ; 4EXY ; 4EY2 ; 4EYB ; 4EYF ; 4EYL ; 4GYQ ; 4GYU ; 4H0D ; 4HKY ; 4HL1 ; 4HL2 ; 4RAM ; 4RAW ; 4RBS ; 4RL0 ; 4RL2 ; 4RM5 ; 4U4L ; 5A5Z ; 5JQJ ; 5K4M ; 5N0H ; 5N0I ; 5NBK ; 5O2E ; 5O2F ; 5WIG ; 5XP6 ; 5XP9 ; 5ZGE ; 5ZGF ; 5ZGI ; 5ZGP ; 5ZGQ ; 5ZGR ; 5ZGT ; 5ZGU ; 5ZGV ; 5ZGW ; 5ZGX ; 5ZGY ; 5ZGZ ; 5ZH1 ; 5ZIO ; 5ZJ1 ; 5ZJ2 ; 5ZJ7 ; 5ZJ8 ; 5ZJC ; 6C6I ; 6CAC ; 6D1A ; 6D1B ; 6D1C ; 6D1D ; 6D1E ; 6D1F ; 6D1G ; 6D1H ; 6D1I ; 6D1J ; 6D1K ; 6EFJ ; 6EX7 ; 6IBS ; 6IBV ; 6MDU ; 6MGY ; 6MGZ ; 6Q2Y ; 6Q30 ; 6RMF
Function This enzyme confers resistance to the different beta-lactams antibiotics (penicillin, cephalosporin and carbapenem) via the hydrolysis of the beta-lactam ring but does not confer resistance to the polymixin colistin or the fluoroquinolone ciprofloxacin.
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:          1 Drugs
Amoxicillin
 Drug Info Approved Acute otitis media ICD11: AB00 [1]
References
1 Interspecies dissemination of a mobilizable plasmid harboring blaIMP-19 and the possibility of horizontal gene transfer in a single patient. Antimicrob Agents Chemother. 2016 Aug 22;60(9):5412-9.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.