Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME2039) | |||||
---|---|---|---|---|---|
DME Name | Acetone carboxylase (ACX), Rhodobacter capsulatus | ||||
Synonyms | Acetone:carbon-dioxide ligase; AMP-forming acetone:carbon-dioxide ligase; RCAP_rcc01338; acxC | ||||
Gene Name | acxC | ||||
UniProt ID | |||||
Gene ID | |||||
EC Number | EC: 6.4.1.6 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Rhodobacter capsulatus (Click to Show/Hide the Complete Species Lineage) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MAYTKAKIKDLVDGKIDRDTLHTMLATPKDADRFVMYLEVLQDQVPWEDRIILPLGPKLY
IVQRKSDHKWVVKSHAGHEFCDWRENWKLHAVMRVRETPEAMEEIYPRLMAPTAGWQVIR EYYCPLSGDLLDVEAPTPWYPVIHDFEPDIDAFYSEWLGLKIPERAA |
||||
Function | This enzyme catalyzes the carboxylation of acetone to form acetoacetate, and it has a reduced activity on butanone, and no activity on 2-pentatone, 3-pentatone, 2-hexanone, chloroacetone, pyruvate, phosphoenolpyruvate, acetaldehyde, propionaldehyde and propylene oxide. And it requires Mg2+ and ATP. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
HSDB-41 |
Drug Info | Preclinical | Epilepsy | ICD11: 8A60 | [1] |
References | |||||
---|---|---|---|---|---|
1 | The human gastric pathogen Helicobacter pylori has a potential acetone carboxylase that enhances its ability to colonize mice. BMC Microbiol. 2008 Jan 23;8:14. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.