Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME2101) | |||||
---|---|---|---|---|---|
DME Name | Glutamate decarboxylase (gadB), Lactobacillus brevis | ||||
Synonyms | Glutamic acid decarboxylase; Bacterial glutamate--ammonia ligase; gad; gadB | ||||
Gene Name | gadA | ||||
UniProt ID | |||||
EC Number | EC: 4.1.1.15 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Lactobacillus brevis (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
AMENYCVSMIAHLWGIPDNEKIYDDFIGTSTVGSSEGCMLGGLALLHSWKHRAKAAGFDI
EDLHSHKPNLVIMSGYQVVWEKFCTYWNVEMRQVPINGDQVSLDMDHVMDYVDENTIGII GIEGITYTGSVDDIQTLDNLVSEYNKTATMPVRIHVDAAFGGLFAPFVDGFNPWDFRLKN VVSINVSGHKYGMVYPGLGWIVWRHNTADILPAEMRFQVPYLGKTVDSIAINFSHSGAHI SAQYYNFIRFGLSGYKTIMQNVRKVSLKLTAALKTYGIFDILVDGSQLPINCWKLADDAP VGWTLYDLESELAKYG |
||||
Function | This enzyme acts on L-cysteate, 3-sulfino-L-alanine and L-aspartate. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
L-glutamine |
Drug Info | Approved | Sickle-cell anaemia | ICD11: 3A51 | [1], [2] |
Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.