Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME2104)
DME Name	FMN-dependent NADH-azoreductase (azoR1), Pseudomonas aeruginosa
Synonyms	Azo-dye reductase 1; FMN-dependent NADH-azo compound oxidoreductase 1; azoR1
Gene Name	azoR1
UniProt ID	AZOR1_PSEAE
Gene ID	882036
EC Number	EC: 1.7.1.17 (Click to Show/Hide the Complete EC Tree) Oxidoreductase Cytochrome acceptor oxidoreductase NAD/NADP acceptor oxidoreductase EC: 1.7.1.17
Lineage	Species: Pseudomonas aeruginosa (Click to Show/Hide the Complete Species Lineage) Kingdom: Bacteria Phylum: Proteobacteria Class: Gammaproteobacteria Order: Pseudomonadales Family: Pseudomonadaceae Genus: Pseudomonas Species: Pseudomonas aeruginosa Subspecies: Pseudomonas aeruginosa PAO1
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Tissue Distribution	Primarily distributed in human gut.
Sequence	MSRILAVHASPRGERSQSRRLAEVFLAAYREAHPQARVARREVGRVPLPAVTEAFVAAAF HPQPEQRSLAMQADLALSDQLVGELFDSDLLVISTPMYNFSVPSGLKAWIDQIVRLGVTF DFVLDNGVAQYRPLLRGKRALIVTSRGGHGFGPGGENQAMNHADPWLRTALGFIGIDEVT VVAAEGEESGGRSFEDSCDEAEQRLLALARSA
Structure	2V9C ; 3KEG ; 3LT5 ; 3R6W ; 4N65 ; 4N9Q
Function	This enzyme catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. And it requires NADH, but not NADPH, as an electron donor for its activity.

Full List of Drug(s) Metabolized by This DME
Drugs Approved by FDA			Click to Show/Hide the Full List of Drugs: 1 Drugs
Balsalazide	Drug Info	Approved	Ulcerative colitis	ICD11: DD71	[1], [2]

References
1	Role of tyrosine 131 in the active site of paAzoR1, an azoreductase with specificity for the inflammatory bowel disease prodrug balsalazide. Acta Crystallogr Sect F Struct Biol Cryst Commun. 2010 Jan 1;66(Pt 1):2-7.
2	Arylamine N-acetyltransferases: from drug metabolism and pharmacogenetics to drug discovery. Br J Pharmacol. 2014 Jun;171(11):2705-25.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.