Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DMEN034) | |||||
---|---|---|---|---|---|
DME Name | Demethylmenaquinone methyltransferase (menG), Staphylococcus aureus | ||||
Gene Name | menG | ||||
UniProt ID | |||||
EC Number | EC: 2.8.2.1 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Staphylococcus aureus (Click to Show/Hide the Complete Species Lineage) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Sequence |
MADNKANKEQVHRVFQNISKKYDRLNNIISFEQHKVWRKRVMKDMGVRKGTKALDVCCGT
GDWTIALSKAVGPTGEVTGIDFSENMLEVGKEKTASMENVKLVHGDAMELPFEDNSFDYV TIGFGLRNVPDYLVALKEMNRVLKPGGMVVCLETSQPTLPVFKQMYALYFKFVMPIFGKL FAKSKEEYEWLQQSTFNFPGKEELKRMFEEAGFINVRVRSFTGGVAAMHLGYKEKDNTKG D |
||||
Function | Methyltransferase required for the conversion of demethylmenaquinol (DMKH2) to menaquinol (MKH2). | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
ACMC-209hn7 |
Drug Info | Investigative | Ulcerative colitis | ICD11: DD71 | [1] |
Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.