Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DMEN098)
DME Name Cytochrome P450 2C70 (Cyp2c70), Mus musculus
Gene Name Cyp2c70
UniProt ID
CP270_MOUSE
EC Number    EC: 1.14.14.-     (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
Oxygen paired donor oxidoreductase
Flavin/flavoprotein donor oxidoreductase
EC: 1.14.14.-
Lineage    Species: Mus musculus     (Click to Show/Hide the Complete Species Lineage)
Kingdom: .
Phylum: .
Class: .
Order: .
Family: .
Genus: .
Species: Mus musculus
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Tissue Distribution Expressed in liver. .
Sequence
MALFIFLGIWLSCFLFLFLWNQHRGRGKLPPGPTPLPIVGNILQVDVKNISKSMGMLAKK
YGPVFTVYLGMKPTVVLHGYKAMKEALIDQGDEFSDKTDSSLLSRTSQGLGIVFSNGETW
KQTRRFSLMVLRSMGMGKKTIEDRIQEEILYMLDALRKTNGSPCDPSFLLACVPCNVIST
VIFQHRFDYNDQTFQDFMENFHRKIEILASPWSQLCSAYPILYYLPGIHNRFLKDVTQQK
KFILEEINRHQKSLDLSNPQDFIDYFLIKMEKEKHNQKSEFTMDNLVVSIGDLFGAGTET
TSSTVKYGLLLLLKYPEVTAKIQEEIAHVIGRHRRPTMQDRNHMPYTDAVLHEIQRYIDF
VPIPSPRKTTQDVEFRGYHIPKGTSVMACLTSVLNDDKEFPNPEKFDPGHFLDEKGNFKK
SDYFVAFSAGRRACIGEGLARMEMFLILTNILQHFTLKPLVKPEDIDTKPVQTGLLHVPP
PFELCFIPV
Function A cytochrome P450 monooxygenase involved in muricholic acid (MCA) synthesis . Hydroxylates at the 6-beta position two major bile acids, chenodeoxycholic acid (CDCA) and ursodeoxycholic acid (UDCA) to form alpha-MCA and beta-MCA, respectively . May regulate NR1H4/farnesoid X receptor signaling, as taurine-conjugated MCAs are antagonists of NR1H4. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase) .
Full List of Drug(s) Metabolized by This DME
      Drugs in Phase 1 Clinical Trial Click to Show/Hide the Full List of Drugs:          1 Drugs
Bile acid
 Drug Info Phase 1 Inflammatory bowel disease ICD11: DD72 [1]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR003845 Bile acid Alpha-MCA Unclear - Unclear Bile acid [1]
MR003852 LCA Murideoxycholic acid Unclear - Unclear Bile acid [1]
MR003849 UDCA Beta-MCA Unclear - Unclear Bile acid [1]
References
1 Bile Acid Metabolism in Liver Pathobiology

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.