Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DMEN133) | |||||
---|---|---|---|---|---|
DME Name | 3-hydroxyanthranilate 3,4-dioxygenase (HAAO), Homo sapiens | ||||
Gene Name | HAAO | ||||
UniProt ID | |||||
EC Number | EC: 1.13.11.6 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Sequence |
MERRLGVRAWVKENRGSFQPPVCNKLMHQEQLKVMFIGGPNTRKDYHIEEGEEVFYQLEG
DMVLRVLEQGKHRDVVIRQGEIFLLPARVPHSPQRFANTVGLVVERRRLETELDGLRYYV GDTMDVLFEKWFYCKDLGTQLAPIIQEFFSSEQYRTGKPIPDQLLKEPPFPLSTRSIMEP MSLDAWLDSHHRELQAGTPLSLFGDTYETQVIAYGQGSSEGLRQNVDVWLWQLEGSSVVT MGGRRLSLAPDDSLLVLAGTSYAWERTQGSVALSVTQDPACKKPLG |
||||
Structure | |||||
Function | Catalyzes the oxidative ring opening of 3-hydroxyanthranilate to 2-amino-3-carboxymuconate semialdehyde, which spontaneously cyclizes to quinolinate. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs in Phase 1 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
TRP-01 |
Drug Info | Phase 1 | Depression | ICD11: 6A71 | [1] |
Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
References | |||||
---|---|---|---|---|---|
1 | Tryptophan and indole metabolism in immune regulation |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.