Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DMEN146) | |||||
---|---|---|---|---|---|
DME Name | Aldehyde dehydrogenase family 1 member A3 (ALDH1A3), Homo sapiens | ||||
Gene Name | ALDH1A3 | ||||
UniProt ID | |||||
EC Number | EC: 1.2.1.36 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Sequence |
MATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFINNEWHESKSGKKFATCNPSTREQI
CEVEEGDKPDVDKAVEAAQVAFQRGSPWRRLDALSRGRLLHQLADLVERDRATLAALETM DTGKPFLHAFFIDLEGCIRTLRYFAGWADKIQGKTIPTDDNVVCFTRHEPIGVCGAITPW NFPLLMLVWKLAPALCCGNTMVLKPAEQTPLTALYLGSLIKEAGFPPGVVNIVPGFGPTV GAAISSHPQINKIAFTGSTEVGKLVKEAASRSNLKRVTLELGGKNPCIVCADADLDLAVE CAHQGVFFNQGQCCTAASRVFVEEQVYSEFVRRSVEYAKKRPVGDPFDVKTEQGPQIDQK QFDKILELIESGKKEGAKLECGGSAMEDKGLFIKPTVFSEVTDNMRIAKEEIFGPVQPIL KFKSIEEVIKRANSTDYGLTAAVFTKNLDKALKLASALESGTVWINCYNALYAQAPFGGF KMSGNGRELGEYALAEYTEVKTVTIKLGDKNP |
||||
Structure | |||||
Function | Catalyzes the NAD-dependent oxidation of aldehyde substrates, such as all-trans-retinal and all-trans-13,14-dihydroretinal, to their corresponding carboxylic acids, all-trans-retinoate and all-trans-13,14-dihydroretinoate, respectively (By similarity) . High specificity for all-trans-retinal as substrate, can also accept acetaldehyde as substrate in vitro but with lower affinity . Required for the biosynthesis of normal levels of retinoate in the embryonic ocular and nasal regions; a critical lipid in the embryonic development of the eye and the nasal region (By similarity). | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 2 Drugs | ||||
Beta carotene |
Drug Info | Approved | Vitamin deficiency | ICD11: 5B55 | [1] |
Cyclobenzaprine |
Drug Info | Approved | Depression | ICD11: 6A71 | [2] |
Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||||||||||||||
References | |||||
---|---|---|---|---|---|
1 | #NAME? | ||||
2 | The KEGG resource for deciphering the genome | ||||
3 | U. S. FDA Label -Cyclobenzaprine |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.