Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DMEN177)
DME Name Isopentenyl-diphosphate delta-isomerase (IDI1), Saccharomyces cerevisiae
Gene Name IDI1
UniProt ID
IDI1_YEAST
EC Number    EC: 5.3.3.2     (Click to Show/Hide the Complete EC Tree)
Isomerase
Intramolecular oxidoreductase
Transposing C=C bonds
EC: 5.3.3.2
Lineage    Species: Saccharomyces cerevisiae     (Click to Show/Hide the Complete Species Lineage)
Kingdom: .
Phylum: .
Class: .
Order: .
Family: .
Genus: .
Species: Saccharomyces cerevisiae
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence
MTADNNSMPHGAVSSYAKLVQNQTPEDILEEFPEIIPLQQRPNTRSSETSNDESGETCFS
GHDEEQIKLMNENCIVLDWDDNAIGAGTKKVCHLMENIEKGLLHRAFSVFIFNEQGELLL
QQRATEKITFPDLWTNTCCSHPLCIDDELGLKGKLDDKIKGAITAAVRKLDHELGIPEDE
TKTRGKFHFLNRIHYMAPSNEPWGEHEIDYILFYKINAKENLTVNPNVNEVRDFKWVSPN
DLKTMFADPSYKFTPWFKIICENYLFNWWEQLDDLSEVENDRQIHRML
Function Isopentenyl-diphosphate delta-isomerase; part of the second module of ergosterol biosynthesis pathway that includes the middle steps of the pathway . IDI1 catalyzes the 1,3-allylic rearrangement of isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP) . The second module is carried out in the vacuole and involves the formation of farnesyl diphosphate, which is also an important intermediate in the biosynthesis of ubiquinone, dolichol, heme and prenylated proteins. Activity by the mevalonate kinase ERG12 first converts mevalonate into 5-phosphomevalonate. 5-phosphomevalonate is then further converted to 5-diphosphomevalonate by the phosphomevalonate kinase ERG8. The diphosphomevalonate decarboxylase MVD1/ERG19 then produces isopentenyl diphosphate. The isopentenyl-diphosphate delta-isomerase IDI1 then catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP). Finally the farnesyl diphosphate synthase ERG20 catalyzes the sequential condensation of isopentenyl pyrophosphate with dimethylallyl pyrophosphate, and then with the resultant geranylpyrophosphate to the ultimate product farnesyl pyrophosphate .
Full List of Drug(s) Metabolized by This DME
      Preclinical/investigative Agents Click to Show/Hide the Full List of Drugs:          1 Drugs
Mevalonate
 Drug Info Investigative Discovery agent ICD: N.A. [1]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR012886 Isopentenyl pyrophosphate Dimethylallyl pyrophosphate Unclear - Unclear Mevalonate [1]
References
1 Evidence of a novel mevalonate pathway in archaea

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.