Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DMEN226) | |||||
---|---|---|---|---|---|
DME Name | Aminoglycoside N(3)-acetyltransferase III (aacC3), Pseudomonas aeruginosa | ||||
Gene Name | aacC3 | ||||
UniProt ID | |||||
EC Number | EC: 2.3.1.81 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Pseudomonas aeruginosa (Click to Show/Hide the Complete Species Lineage) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Sequence |
MTDLNIPHTHAHLVDAFQALGIRAGQALMLHASVKAVGAVMGGPNVILQALMDALTPDGT
LMMYAGWQDIPDFIDSLPDALKAVYLEQHPPFDPATARAVRENSVLAEFLRTWPCVHRSA NPEASMVAVGRQAALLTANHALDYGYGVESPLAKLVAIEGYVLMLGAPLDTITLLHHAEY LAKMRHKNVVRYPCPILRDGRKVWVTVEDYDTGDPHDDYSFEQIARDYVAQGGGTRGKVG DADAYLFAAQDLTRFAVQWLESRFGDSASYG |
||||
Structure | |||||
Function | Resistance to antibiotics containing the 2-deoxy-streptamine ring including dibekacin, gentamicin, kanamycin, sisomicin, tobramycin and neomycin, but not to amikacin or netilmicin . Acetylates a broad range of both 4,5- and 4,6-disubstituted aminoglycosides, including neomycin, paromomycin, ribostamycin, sisomicin, gentamicin, tobramycin and kanamycin, with no preference of one disubstitution over the other. Acetylates sisomicin and kanamycin most and least efficiently, respectively. Does not modify plazomicin . | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs in Phase 4 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Dibekacin |
Drug Info | Phase 4 | Acute lower respiratory infection | ICD11: CA4Z | [1] |
Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.