Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DMEN302) | |||||
---|---|---|---|---|---|
DME Name | UDP-glucuronosyltransferase 2B1 (Ugt2b1), Rattus norvegicus | ||||
Gene Name | Ugt2b1 | ||||
UniProt ID | |||||
EC Number | EC: 2.4.1.17 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Rattus norvegicus (Click to Show/Hide the Complete Species Lineage) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Sequence |
MSMKQTSVFLLIQLICYFRPGACGKVLVWPTEYSHWINIKIILNELAQRGHEVTVLVSSA
SILIEPTKESSINFEIYSVPLSKSDLEYSFAKWIDEWTRDFETLSIWTYYSKMQKVFNEY SDVVENLCKALIWNKSLMKKLQGSQFDVILADAVGPCGELLAELLKTPLVYSLRFCPGYR CEKFSGGLPLPPSYVPVVLSELSDRMTFVERVKNMLQMLYFDFWFQPFKEKSWSQFYSDV LGRPTTLTEMMGKADIWLIRTFWDLEFPHPFLPNFDFVGGLHCKPAKPLPREMEEFVQSS GEHGVVVFSLGSMVKNLTEEKANVVASALAQIPQKVVWRFDGKKPDTLGSNTRLYKWIPQ NDLLGHPKTKAFVAHGGTNGIYEAIYHGIPIVGIPLFADQPDNINHMVAKGAAVRVDFSI LSTTGLLTALKIVMNDPSYKENAMRLSRIHHDQPVKPLDRAVFWIEYVMRHKGAKHLRST LHDLSWFQYHSLDVIGFLLLCVVGVVFIITKFCLFCCRKTANMGKKKKE |
||||
Function | UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile . Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds . Catalyzes the glucuronidation of the endogenous estrogen hormone estradiol . | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Osilodrostat |
Drug Info | Approved | Cushing syndrome | ICD11: 5A70 | [1] |
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Tetramethylbutylphenol |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [2] |
Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||||||||||||||
References | |||||
---|---|---|---|---|---|
1 | DrugBank(Pharmacology-Metabolism):Osilodrostat | ||||
2 | Differential metabolism of 4-n- and 4-tert-octylphenols in perfused rat liver |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.