Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DMEN775) | |||||
---|---|---|---|---|---|
DME Name | Acyl-CoA hydrolase (ACAA2), Homo sapiens | ||||
Gene Name | ACAA2 | ||||
UniProt ID | |||||
EC Number | EC: 2.3.1.16 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Sequence |
MALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVL
QSSSDAIYLARHVGLRVGIPKETPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTE SMSQAPYCVRNVRFGTKLGSDIKLEDSLWVSLTDQHVQLPMAMTAENLAVKHKISREECD KYALQSQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFK KDGTVTAGNASGVADGAGAVIIASEDAVKKHNFTPLARIVGYFVSGCDPSIMGIGPVPAI SGALKKAGLSLKDMDLVEVNEAFAPQYLAVERSLDLDISKTNVNGGAIALGHPLGGSGSR ITAHLVHELRRRGGKYAVGSACIGGGQGIAVIIQSTA |
||||
Structure | |||||
Function | In the production of energy from fats, this is one of the enzymes that catalyzes the last step of the mitochondrial beta-oxidation pathway, an aerobic process breaking down fatty acids into acetyl-CoA (Probable). Using free coenzyme A/CoA, catalyzes the thiolytic cleavage of medium- to long-chain unbranched 3-oxoacyl-CoAs into acetyl-CoA and a fatty acyl-CoA shortened by two carbon atoms (Probable). Also catalyzes the condensation of two acetyl-CoA molecules into acetoacetyl-CoA and could be involved in the production of ketone bodies (Probable). Also displays hydrolase activity on various fatty acyl-CoAs . Thereby, could be responsible for the production of acetate in a side reaction to beta-oxidation (Probable). Abolishes BNIP3-mediated apoptosis and mitochondrial damage . | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs in Phase 2 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Phenylbutyrate |
Drug Info | Phase 2 | Phenylketonuria | ICD11: 5C50 | [1] |
References | |||||
---|---|---|---|---|---|
1 | New secondary metabolites of phenylbutyrate in humans and rats |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.