Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN857) | |||||
|---|---|---|---|---|---|
| DME Name | NADPH-dependent carbonyl reductase (Dhrs4), Mus musculus | ||||
| Gene Name | Dhrs4 | ||||
| UniProt ID | |||||
| EC Number | EC: 1.1.1.184 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Mus musculus (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MQKAGRLLGGWTQAWMSVRMASSGLTRRNPLSNKVALVTASTDGIGFAIARRLAEDGAHV
VVSSRKQQNVDRAVATLQGEGLSVTGIVCHVGKAEDREKLITTALKRHQGIDILVSNAAV NPFFGNLMDVTEEVWDKVLSINVTATAMMIKAVVPEMEKRGGGSVVIVGSVAGFTRFPSL GPYNVSKTALLGLTKNFAAELAPKNIRVNCLAPGLIKTRFSSVLWEEKAREDFIKEAMQI RRLGKPEDCAGIVSFLCSEDASYINGETVVVGGGTPSRL |
||||
| Function | NADPH-dependent oxidoreductase which catalyzes the reduction of a variety of compounds bearing carbonyl groups including ketosteroids, alpha-dicarbonyl compounds, aldehydes, aromatic ketones and quinones. Reduces all-trans-retinal and 9-cis retinal. Reduces 3-ketosteroids and benzil into 3alpha-hydroxysteroids and S-benzoin, respectively, in contrast to the stereoselectivity of primates DHRS4s which produce 3beta-hydroxysteroids and R-benzoin. In the reverse reaction, catalyzes the NADP-dependent oxidation of 3alpha-hydroxysteroids and alcohol, but with much lower efficiency. Involved in the metabolism of 3alpha-hydroxysteroids, retinoid, isatin and xenobiotic carbonyl compounds. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Metyrapone |
Drug Info | Approved | Cushing syndrome | ICD11: 5A70 | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | Reductive metabolism of metyrapone by a quercitrin-sensitive ketone reductase in mouse liver cytosol | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.