Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DMEN870) | |||||
---|---|---|---|---|---|
DME Name | Beta-lactamase PSE-1 (pse1), Pseudomonas aeruginosa | ||||
Gene Name | pse1 | ||||
UniProt ID | |||||
EC Number | EC: 3.5.2.6 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Pseudomonas aeruginosa (Click to Show/Hide the Complete Species Lineage) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Sequence |
MKFLLAFSLLIPSVVFASSSKFQQVEQDVKAIEVSLSARIGVSVLDTQNGEYWDYNGNQR
FPLTSTFKTIACAKLLYDAEQGKVNPNSTVEIKKADLVTYSPVIEKQVGQAITLDDACFA TMTTSDNTAANIILSAVGGPKGVTDFLRQIGDKETRLDRIEPDLNEGKLGDLRDTTTPKA IASTLNKFLFGSALSEMNQKKLESWMVNNQVTGNLLRSVLPAGWNIADRSGAGGFGARSI TAVVWSEHQAPIIVSIYLAQTQASMAERNDAIVKIGHSIFDVYTSQSR |
||||
Function | Hydrolyzes penicillin, ampicillin and carbenicillin but not other antibiotics including oxacillin, methicillin and cloxacillin. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Azlocillin |
Drug Info | Approved | Pseudomonas infection | ICD11: 1B92 | [1] |
References | |||||
---|---|---|---|---|---|
1 | Degradation of azlocillin in human serum |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.