Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1086) | |||||
---|---|---|---|---|---|
DME Name | VanA ligase (vanA), Enterococcus faecium | ||||
Synonyms | Vancomycin/teicoplanin A-type resistance protein VanA; D-alanylalanine synthetase VanA; D-alanine--D-alanine ligase VanA; D-Ala-D-Ala ligase VanA; vanA | ||||
Gene Name | vanA | ||||
UniProt ID | |||||
Gene ID | |||||
EC Number | EC: 6.3.2.4 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Enterococcus faecium (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MNRIKVAILFGGCSEEHDVSVKSAIEIAANINKEKYEPLYIGITKSGVWKMCEKPCAEWE
NDNCYSAVLSPDKKMHGLLVKKNHEYEINHVDVAFSALHGKSGEDGSIQGLFELSGIPFV GCDIQSSAICMDKSLTYIVAKNAGIATPAFWVINKDDRPVAATFTYPVFVKPARSGSSFG VKKVNSADELDYAIESARQYDSKILIEQAVSGCEVGCAVLGNSAALVVGEVDQIRLQYGI FRIHQEVEPEKGSENAVITVPADLSAEERGRIQETAKKIYKALGCRGLARVDMFLQDNGR IVLNEVNTLPGFTSYSRYPRMMAAAGIALPELIDRLIVLALKG |
||||
Structure | |||||
Function | This enzyme is required for high-level resistance to glycopeptide antibiotics. D-Ala--D-Ala ligase of altered specificity catalyzes ester bond formation between D-Ala and various D-hydroxy acids and produces a peptidoglycan which does not terminate in D-alanine but in D-lactate, thus preventing vancomycin or teicoplanin binding. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Vancomycin |
Drug Info | Approved | Methicillin-resistant staphylococcus infection | ICD11: 1D01 | [1] |
Drugs in Phase 4 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Teicoplanin |
Drug Info | Phase 4 | Staphylococcus infection | ICD11: 1B73 | [1] |
References | |||||
---|---|---|---|---|---|
1 | Genetics and mechanisms of glycopeptide resistance in enterococci. Antimicrob Agents Chemother. 1993 Aug;37(8):1563-71. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.