Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1195) | |||||
---|---|---|---|---|---|
DME Name | Beta-mannosidase (manB), Bacteroides salyersiae | ||||
Synonyms | Mannan endo-1,4-beta-mannosidase; Beta-mannoside mannohydrolase; BetaMANNOS1; HMPREF1071_04441 | ||||
Gene Name | manB | ||||
UniProt ID | |||||
EC Number | EC: 3.2.1.78 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Bacteroides salyersiae (Click to Show/Hide the Complete Species Lineage) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MKNSFLIGIIIISFFSCKTPMKNKMPTDPQATHETVALYNRLFNLAEKGIMLGHQDDPLY
GHGWYGEQDRSDVKGMIGDYPAIFGFELGHIELDSEYSLDSVYFSQIKKHVKEHHARGGI SSFSWHADNIATGNSTWDCAQDTVVRSILPGGSLHKEYLVWLERLANFFLDLKDENGAYI PVIFRMYHEHTGDWFWWSSQQSTPEEYKQLWIMTCDYLQKTKQVHHLLYAYSSSNVQSEE HYLERYPGDQYVDILGFDHYLKGREQKNVEQYKIDFERNIKIVTKCAEQSGKLPVIGETG EESIWDPTYFTNVVYPIINKYKLGWILFWRNAWEPDKPNHYYLPYPGHSSESDFKQFVDQ PLILTNKDVYQQ |
||||
Function | This enzyme catalyzes the hydrolysis of terminal, non-reducing beta-D-mannose residues in beta-D-mannosides. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 3 Drugs | ||||
W-201259 |
Drug Info | Preclinical | Salmonella infection | ICD11: 1A09 | [1] |
Man-b-4MU |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1] |
Mannotetraose |
Drug Info | Investigative | Alzheimer disease | ICD11: 8A20 | [1] |
Experimental Enzyme Kinetic Data of Drugs | Click to Show/Hide the Full List of Drugs: 3 Drugs | ||||
W-201259 |
Drug Info | Preclinical | Salmonella infection | Kcat/Km = 0.0022 s-1microM-1 | [1] |
Man-b-4MU |
Drug Info | Investigative | Discovery agent | Km = 1050 microM | [1] |
Mannotetraose |
Drug Info | Investigative | Alzheimer disease | Kcat/Km = 0.0045 s-1microM-1 | [1] |
Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||||||||||||||
References | |||||
---|---|---|---|---|---|
1 | Structure and function of Bs164 beta-mannosidase from Bacteroides salyersiae the founding member of glycoside hydrolase family GH164. J Biol Chem. 2020 Mar 27;295(13):4316-4326. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.