Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1214) | |||||
---|---|---|---|---|---|
DME Name | Beta-lactamase (blaB), Bacillus megaterium | ||||
Synonyms | Penicillinase; Cephalosporinase; Beta-lactam; Metallo-beta-lactamase type 2a; Metallo-beta-lactamase type IIa; Metallothioprotein beta-lactamase IIa; Zinc-requiring beta-lactamase Iia | ||||
Gene Name | blaB | ||||
UniProt ID | |||||
EC Number | EC: 3.5.2.6 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Bacillus megaterium (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MKKNTLLKVGLCVSLLGTTQFVSTISSVQASQKVEQIVIKNETGTISISQLNKNVWVHTE
LGYFNGEAVPSNGLVLNTSKGLVLVDSSWDNKLTKELIEMVEKKFQKRVTDVIITHAHAD RIGGITALKERGIKAHSTALTAELAKKSGYEEPLGDLQTVTNLKFGNTKVETFYPGKGHT EDNIVVWLPQYQILAGGCLVKSAEAKNLGNVADAYVNEWSTSIENMLKRYRNINLVVPGH GKVGDKGLLLHTLDLLK |
||||
Function | This enzyme confers resistance to the different beta-lactams antibiotics (penicillin, cephalosporin and carbapenem) via the hydrolysis of the beta-lactam ring. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Ampicillin |
Drug Info | Approved | Endocarditis | ICD11: 1B12 | [1] |
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Ceftiofur |
Drug Info | Investigative | Superficial thrombophlebitis | ICD11: BD70 | [2], [3] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.