Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1308) | |||||
---|---|---|---|---|---|
DME Name | Beta-lactamase (blaB), Prevotella veroralis | ||||
Synonyms | Penicillinase; Cephalosporinase; Beta-lactam; HMPREF0973_01058 | ||||
Gene Name | blaB | ||||
UniProt ID | |||||
EC Number | EC: 3.5.2.6 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Prevotella veroralis (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human oral cavity. | ||||
Sequence |
MIHRSYTLFLIATILLFTSCSVFRGFSLDGFSGPDIYEYQKLERDTIRKGSNVFHFPLVE
SHRKIRGDFRLKYKDSGRMRLDSLVEQWFGKDNQLLIIHNDSVVYDQWTEPFYPGKNATV FSVSKSLTALLCGIAIDEGYIKSVDDPVTDYIPELAQYNPTFRSLRIIHLLNMQAGFDFK EHYEFTLKSMSSIAKMAQLQYGHDFTRLFRHVKFKYQPGEKYEYNSLTTALLSWIIERAT GKNYAHYMSEKVWKPLGMEHDAWVTIDSRKHHHAQGFGGIATNVYDLAKIGRLYLNRGKW EGKQIVREEWINRSLETTSENKGYHYCWYYQYYDDKTDNSSFYAFGVGHQFIYINQKKNV IITRIGNNYNWKWWEMSFFDALCNKLF |
||||
Function | This enzyme hydrolyzes beta-lactam. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Amoxicillin |
Drug Info | Approved | Acute otitis media | ICD11: AB00 | [1] |
References | |||||
---|---|---|---|---|---|
1 | Detection and characterization of beta-lactamase genes in subgingival bacteria from patients with refractory periodontitis. FEMS Microbiol Lett. 2005 Jan 15;242(2):319-24. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.