Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1340) | |||||
---|---|---|---|---|---|
DME Name | Nitroreductase (NTR), Bacteroides fragilis | ||||
Synonyms | FMN reductase (NAD(P)H); FMN reductase NADPH; nfrA2; CQW34_03043; HMPREF1018_03053 | ||||
Gene Name | nfrA2 | ||||
UniProt ID | |||||
EC Number | EC: 1.5.1.39 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Bacteroides fragilis (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MIILFISLQKKDMMDTVKNRRTIRKYQQKDITPDLLNDLLETSFRASTMGGMQLYSVVVT
RDAEKKEILSPAHFNQPMVKEAPVVLTFCADFRRFCKYCQERNAVPGYGNLMSFLNAAMD TLLVAQTFCTLAEEAGLGICYLGTTTYNPQMIIDALHLPELVFPITTVTVGYPAESPKQV DRLPIEGIIHEESYHDYTAEDINRLYAYKESLPENKLFIEENQKETLAQVFTDVRYTKKD NEFMSENLLKVLRRQGFMD |
||||
Function | This enzyme contains FMN and can utilize NADH and NADPH with similar reaction rates. It also reduces riboflavin and FAD, but more slowly. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Metronidazole |
Drug Info | Approved | Amebiasis | ICD11: 1A36 | [1], [2] |
Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||||||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.