Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1347) | |||||
---|---|---|---|---|---|
DME Name | Beta-lactamase (blaB), Bacteroides stercoris | ||||
Synonyms | Penicillinase; Cephalosporinase; Beta-lactam; per1; bla; AA415_02475; DXC34_16285 | ||||
Gene Name | per1 | ||||
UniProt ID | |||||
EC Number | EC: 3.5.2.6 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Bacteroides stercoris (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MKLRYTLIGVLCFSINIVLQAQQQALEGKIAGFLKGKKATVGVAVLTDKDETILHNNEVH
YPLLSVFKFHVALAVLDKMNREEIPLKHIVHVKASQLQPNTYSPLRQKHSGQDLDISLGE LLQYSISLSDNNACDILIEYTGGIGHIHQYIRKLGINDFNLSETEDSMHRNPQKAYANWS TPSEMVRLLKMADEKDLFAPVYRDFLWKTMTETATGSNKLKGLLPSNTVVGHKTGSSDRN LKGVKMADNDAGIVIMPGGKKYYIAVFVTDSSETDEENAAIIAHISRMVYDEMK |
||||
Function | This enzyme hydrolyzes beta-lactam. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Amoxicillin |
Drug Info | Approved | Acute otitis media | ICD11: AB00 | [1] |
References | |||||
---|---|---|---|---|---|
1 | Prevalence of antimicrobial resistance genes in Bacteroides spp. and Prevotella spp. Dutch clinical isolates. Clin Microbiol Infect. 2019 Sep;25(9):1156.e9-1156.e13. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.