Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1512) | |||||
---|---|---|---|---|---|
DME Name | L-Lactate dehydrogenase (ldh), Lactobacillus casei | ||||
Synonyms | L-lactate ferricytochrome C oxidoreductase; Cytochrome b2 mitochondrial; L-LCR; L-LDH; ldh | ||||
Gene Name | ldh | ||||
UniProt ID | |||||
Gene ID | |||||
EC Number | EC: 1.1.1.27 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Lactobacillus casei (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MASITDKDHQKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPF
TSPKKIYSAEYSDAKDADLVVITAGAPQKPGETRLDLVNKNLKILKSIVDPIVDSGFNGI FLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSVHAYIMGE HGDTEFPVWSHANIGGVTIAEWVKAHPEIKEDKLVKMFEDVRDAAYEIIKLKGATFYGIA TALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEE SMQKSASQLKKVLTDAFAKNDIETRQ |
||||
Structure | |||||
Function | This enzyme catalyzes the conversion of lactate to pyruvate, and it also oxidizes other (S)-2-hydroxymonocarboxylic acids. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs in Phase 1 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
DB-053072 |
Drug Info | Phase 1 | Prostate cancer | ICD11: 2C82 | [1] |
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 2 Drugs | ||||
Methylglyoxal |
Drug Info | Investigative | Alzheimer disease | ICD11: 8A20 | [2] |
Glucose-bisphosphate |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1] |
Experimental Enzyme Kinetic Data of Drugs | Click to Show/Hide the Full List of Drugs: 2 Drugs | ||||
DB-053072 |
Drug Info | Phase 1 | Prostate cancer | Km = 1000 microM | [1] |
Glucose-bisphosphate |
Drug Info | Investigative | Discovery agent | Km = 10 microM | [1] |
Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.