Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1559) | |||||
---|---|---|---|---|---|
DME Name | PenA beta-lactamase (penA1), Burkholderia cepacia | ||||
Synonyms | Beta-lactamase penA; Penicillinase penA; Cephalosporinase penA; penA | ||||
Gene Name | penA | ||||
UniProt ID | |||||
EC Number | EC: 3.5.2.6 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Burkholderia cepacia (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human lung. | ||||
Sequence |
MTHSSQRRILLLAAATAPLALSLGACAARDATVSDAASPVGAAPASFAALERAAGGRLGV
CAIDTATGRRALHRADERFPFCSTFKAMLGAAVLAQSVAHPGLLQQRVTYGRSDLVNYSP VTERHVDTGMTVAELCAATIQYSDNTAANELMKRIGGPAAVTAYARSIGDDTFRLDRWET ELNTALPGDLRDTTTPAAMAANLRVLVLGDALPPAQRAQLIEWLRGNKVGDKRIRAGVPT GWRVGDKTGTGDYGTTNDVGVLWPPSRAPIVLAVYYTQTRADAKAKDDVIAAATRIASAT LA |
||||
Function | This enzyme hydrolyzes beta-lactam. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 3 Drugs | ||||
Cefotaxime |
Drug Info | Approved | Meningitis | ICD11: 1A62 | [1] |
Carbenicillin |
Drug Info | Approved | Infectious cystitis | ICD11: GC00 | [1] |
Oxacillin |
Drug Info | Approved | Pseudomonas infection | ICD11: 1G40 | [1] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.