Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN224) | |||||
|---|---|---|---|---|---|
| DME Name | Mitochondrial inner membrane protein OXA1L (OXA1L), Homo sapiens | ||||
| Gene Name | OXA1L | ||||
| UniProt ID | |||||
| Lineage | Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MAMGLMCGRRELLRLLQSGRRVHSVAGPSQWLGKPLTTRLLFPVAPCCCRPHYLFLAASG
PRSLSTSAISFAEVQVQAPPVVAATPSPTAVPEVASGETADVVQTAAEQSFAELGLGSYT PVGLIQNLLEFMHVDLGLPWWGAIAACTVFARCLIFPLIVTGQREAARIHNHLPEIQKFS SRIREAKLAGDHIEYYKASSEMALYQKKHGIKLYKPLILPVTQAPIFISFFIALREMANL PVPSLQTGGLWWFQDLTVSDPIYILPLAVTATMWAVLELGAETGVQSSDLQWMRNVIRMM PLITLPITMHFPTAVFMYWLSSNLFSLVQVSCLRIPAVRTVLKIPQRVVHDLDKLPPREG FLESFKKGWKNAEMTRQLREREQRMRNQLELAARGPLRQTFTHNPLLQPGKDNPPNIPSS SSKPKSKYPWHDTLG |
||||
| Structure | |||||
| Function | Required for the insertion of integral membrane proteins into the mitochondrial inner membrane. Essential for the activity and assembly of cytochrome oxidase. Required for the correct biogenesis of ATP synthase and complex I in mitochondria. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Ketoprofen glucuronide |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Stereoselective esterase activity of human serum albumin toward ketoprofen glucuronide | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.