Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DMEN301)
DME Name UDP-galactose translocator (SLC35A2), Homo sapiens
Gene Name SLC35A2
UniProt ID
S35A2_HUMAN
Lineage    Species: Homo sapiens     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence
MAAVGAGGSTAAPGPGAVSAGALEPGTASAAHRRLKYISLAVLVVQNASLILSIRYARTL
PGDRFFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSL
IYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVA
IVQAQQAGGGGPRPLDQNPGAGLAAVVASCLSSGFAGVYFEKILKGSSGSVWLRNLQLGL
FGTALGLVGLWWAEGTAVATRGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFA
TSLSIVLSTVASIRLFGFHVDPLFALGAGLVIGAVYLYSLPRGAAKAIASASASASGPCV
HQQPPGQPPPPQLSSHRGDLITEPFLPKLLTKVKGS
Function Transports uridine diphosphate galactose (UDP-galactose) from the cytosol into the Golgi apparatus, functioning as an antiporter that exchanges UDP-galactose for UMP . It is also able to exchange UDP-galactose for AMP and CMP, and to transport UDP-N-acetylgalactosamine (UDP-GalNAc) and other nucleotide sugars . As a provider of UDP-galactose to galactosyltransferases present in the Golgi apparatus, it is necessary for globotriaosylceramide/globoside (Gb3Cer) synthesis from lactosylceramide .
Full List of Drug(s) Metabolized by This DME
      Drugs in Phase 3 Clinical Trial Click to Show/Hide the Full List of Drugs:          2 Drugs
PG-490
 Drug Info Phase 3 Diabetes mellitus ICD11: 5A10 [1]
Q-100648
 Drug Info Phase 3 Eclampsia ICD11: JA25 [2]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR006398 Hydroxytriptolide Hydroxytriptolide glucuronoside Conjugation - Conjugation PG-490 [1]
MR006420 N-demethylanisodamine Glucuronide conjugated N-demethylanisodamine Conjugation - Conjugation Q-100648 [2]
MR006423 Q-100648 Glucuronide conjugated anisodamine Conjugation - Conjugation Q-100648 [2]
MR009535 Rilpivirine M4 Rilpivirine M7 Conjugation - Glucuronidation Rilpivirine hydrochloride [3]
References
1 Preclinical pharmacokinetics of triptolide: a potential antitumor drug. Curr Drug Metab. 2019;20(2):147-154.
2 Liquid chromatography-tandem mass spectrometry analysis of anisodamine and its phase I and II metabolites in rat urine
3 Human biotransformation of the nonnucleoside reverse transcriptase inhibitor rilpivirine and a cross-species metabolism comparison. Antimicrob Agents Chemother. 2013 Oct;57(10):5067-79.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.