Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DMEN780) | |||||
---|---|---|---|---|---|
DME Name | L-proline trans-4-hydroxylase (P4H), . | ||||
Gene Name | P4H | ||||
UniProt ID | |||||
EC Number | EC: 1.14.11.57 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: . (Click to Show/Hide the Complete Species Lineage) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Sequence |
MSVSAPLLDAKVRYGRDGWLPLPHTLSDPDVRKLRQRIEGISREQRPEVVLEEGSSAVRA
LHGCHDFDEVCARLVRLPALVGLAEQLLGGPVYVYQFKVNMKQAHEGAAWPWHQDFAFWH HEDGMGAPDAVNIAIFLDDVTDENGPLEVIPGSQHAGIVEDTARPGRERSHDWRHHVSAK LEYVVPDEIAGRLAGTFGVRRLTGPAGTAVAFHPSIIHSSSNNTSAQRRCVLLITYNRVT NTPAHPVRPPFLVSRDSTPVVPVDADRL |
||||
Function | Involved in the biosynthesis of the peptidolactone antibiotic etamycin (viridogrisein) . Catalyzes the hydroxylation of free L-proline at the C-4 position to yield trans-4-hydroxy-L-proline . | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
L-Proline |
Drug Info | Approved | Malnutrition | ICD11: 5B50-5B71 | [1] |
Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
References | |||||
---|---|---|---|---|---|
1 | Structures of L-proline trans-hydroxylase reveal the catalytic specificity and provide deeper insight into AKG-dependent hydroxylation |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.