Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME0628)
DME Name	Short-chain dehydrogenase/reductase SDR19C1 (DHRS1), Homo sapiens
Synonyms	Short chain dehydrogenase/reductase family 19C member 1; Dehydrogenase/reductase SDR family member 1; Short-chain dehydrogenase/reductase 1; DHRS1; SDR19C1
Gene Name	DHRS1
UniProt ID	DHRS1_HUMAN
Gene ID	115817
EC Number	EC: 1.1.1.- (Click to Show/Hide the Complete EC Tree) Oxidoreductase CH-OH donor oxidoreductase NAD/NADP oxidoreductase EC: 1.1.1.-
Lineage	Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence	MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVP VVCDSSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDIN NVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVPYGVGKAACDKLAADCAHE LRRHGVSCVSLWPGIVQTELLKEHMAKEEVLQDPVLKQFKSAFSSAETTELSGKCVVALA TDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSSVLSHVSGLGWLASYLPSFLR VPKWIIALYTSKF
Structure	2QQ5
Function	This enzyme can catalyse the in vitro reductive conversion of some steroids (estrone, androstene-3,17-dione and cortisone), as well as other endogenous substances and xenobiotics.

Full List of Drug(s) Metabolized by This DME
Drugs Approved by FDA			Click to Show/Hide the Full List of Drugs: 1 Drugs
Ketotifen	Drug Info	Approved	Conjunctivitis	ICD11: 9A60	[1]

Tissue/Disease-Specific Protein Abundances of This DME
Tissue-specific Protein Abundances in Healthy Individuals		Click to Show/Hide

Download the Tissue-Specific Variation(s) Profile
ICD Disease Classification 01	Infectious/parasitic disease	Click to Show/Hide
ICD-11: 1G41	Sepsis with septic shock	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.41E-10; Fold-change: 3.17E-01; Z-score: 9.30E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 02	Neoplasm	Click to Show/Hide
ICD-11: 2A00	Brain cancer	Click to Show/Hide
The Studied Tissue	Nervous tissue
The Specified Disease	Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.43E-30; Fold-change: 2.83E-01; Z-score: 7.61E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.84E-02; Fold-change: -1.39E-01; Z-score: -6.30E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A36	Myelodysplastic syndrome	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.53E-01; Fold-change: 3.15E-02; Z-score: 6.85E-02
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.08E-01; Fold-change: 1.84E-01; Z-score: 2.13E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2A81	Diffuse large B-cell lymphoma	Click to Show/Hide
The Studied Tissue	Tonsil tissue
The Specified Disease	Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.61E-01; Fold-change: 7.58E-02; Z-score: 7.66E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2A83	Plasma cell neoplasm	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.10E-03; Fold-change: -3.38E-01; Z-score: -1.55E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.63E-01; Fold-change: -1.24E-02; Z-score: -2.81E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2B33	Leukaemia	Click to Show/Hide
The Studied Tissue	Bone marrow
The Specified Disease	Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.20E-37; Fold-change: -6.93E-01; Z-score: -1.87E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2B6E	Oral cancer	Click to Show/Hide
The Studied Tissue	Oral tissue
The Specified Disease	Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.23E-05; Fold-change: -1.06E+00; Z-score: -1.16E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.10E-13; Fold-change: -9.83E-01; Z-score: -1.11E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B70	Esophageal cancer	Click to Show/Hide
The Studied Tissue	Esophagus
The Specified Disease	Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.33E-02; Fold-change: -1.49E+00; Z-score: -1.41E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: 2B72	Stomach cancer	Click to Show/Hide
The Studied Tissue	Gastric tissue
The Specified Disease	Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.04E-01; Fold-change: -3.74E-01; Z-score: -1.02E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 8.43E-03; Fold-change: -3.07E-01; Z-score: -9.72E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B90	Colon cancer	Click to Show/Hide
The Studied Tissue	Colon tissue
The Specified Disease	Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.94E-67; Fold-change: -9.59E-01; Z-score: -2.33E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.17E-41; Fold-change: -9.12E-01; Z-score: -1.64E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2B92	Rectal cancer	Click to Show/Hide
The Studied Tissue	Rectal colon tissue
The Specified Disease	Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.41E-04; Fold-change: -6.86E-01; Z-score: -2.63E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.04E-02; Fold-change: -8.58E-01; Z-score: -1.27E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C10	Pancreatic cancer	Click to Show/Hide
The Studied Tissue	Pancreas
The Specified Disease	Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.09E-02; Fold-change: 2.80E-01; Z-score: 5.50E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.05E-01; Fold-change: 1.44E-01; Z-score: 2.76E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C12	Liver cancer	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.41E-11; Fold-change: -1.50E+00; Z-score: -1.63E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.73E-100; Fold-change: -1.82E+00; Z-score: -3.28E+00
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 1.36E-02; Fold-change: -1.51E+00; Z-score: -2.84E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual Download DME expression data in the tissue of the other disease section
ICD-11: 2C25	Lung cancer	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.54E-01; Fold-change: -2.09E-02; Z-score: -6.05E-02
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.31E-03; Fold-change: -1.04E-01; Z-score: -2.23E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C30	Skin cancer	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.55E-71; Fold-change: -1.48E+00; Z-score: -2.55E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.39E-29; Fold-change: -7.03E-01; Z-score: -1.50E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C6Z	Breast cancer	Click to Show/Hide
The Studied Tissue	Breast tissue
The Specified Disease	Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.10E-14; Fold-change: -3.23E-01; Z-score: -5.53E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 8.70E-02; Fold-change: -1.06E-01; Z-score: -2.20E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C73	Ovarian cancer	Click to Show/Hide
The Studied Tissue	Ovarian tissue
The Specified Disease	Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.75E-04; Fold-change: 6.15E-01; Z-score: 1.90E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.32E-01; Fold-change: 2.40E-01; Z-score: 7.18E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C78	Uterine cancer	Click to Show/Hide
The Studied Tissue	Endometrium tissue
The Specified Disease	Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.26E-01; Fold-change: 2.78E-01; Z-score: 3.28E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.14E-01; Fold-change: -9.61E-02; Z-score: -1.76E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C82	Prostate cancer	Click to Show/Hide
The Studied Tissue	Prostate
The Specified Disease	Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.30E-02; Fold-change: -2.07E-01; Z-score: -2.53E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C90	Renal cancer	Click to Show/Hide
The Studied Tissue	Kidney
The Specified Disease	Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.81E-03; Fold-change: -6.17E-01; Z-score: -1.42E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.13E-18; Fold-change: -4.62E-01; Z-score: -1.15E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2C92	Ureter cancer	Click to Show/Hide
The Studied Tissue	Urothelium
The Specified Disease	Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.51E-01; Fold-change: -1.32E-01; Z-score: -3.85E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2C94	Bladder cancer	Click to Show/Hide
The Studied Tissue	Bladder tissue
The Specified Disease	Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.21E-03; Fold-change: -6.15E-01; Z-score: -2.00E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D02	Retinal cancer	Click to Show/Hide
The Studied Tissue	Uvea
The Specified Disease	Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.55E-05; Fold-change: 7.68E-01; Z-score: 4.00E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D10	Thyroid cancer	Click to Show/Hide
The Studied Tissue	Thyroid
The Specified Disease	Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.90E-02; Fold-change: 2.41E-01; Z-score: 7.14E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.12E-01; Fold-change: 2.29E-01; Z-score: 6.41E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 2D11	Adrenal cancer	Click to Show/Hide
The Studied Tissue	Adrenal cortex
The Specified Disease	Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 1.03E-07; Fold-change: -3.68E-01; Z-score: -1.24E+00
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
ICD-11: 2D12	Endocrine gland neoplasm	Click to Show/Hide
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.35E-03; Fold-change: 3.86E-01; Z-score: 1.56E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 2D42	Head and neck cancer	Click to Show/Hide
The Studied Tissue	Head and neck tissue
The Specified Disease	Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.37E-03; Fold-change: 9.01E-02; Z-score: 8.87E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 03	Blood/blood-forming organ disease	Click to Show/Hide
ICD-11: 3A51	Sickle cell disorder	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.36E-02; Fold-change: -5.09E-01; Z-score: -8.35E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3B63	Thrombocytosis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.04E-02; Fold-change: -1.25E-01; Z-score: -7.98E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 3B64	Thrombocytopenia	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.19E-01; Fold-change: 6.45E-01; Z-score: 8.82E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 04	Immune system disease	Click to Show/Hide
ICD-11: 4A40	Lupus erythematosus	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.97E-09; Fold-change: 7.29E-01; Z-score: 8.49E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A42	Systemic sclerosis	Click to Show/Hide
The Studied Tissue	Whole blood
The Specified Disease	Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.57E-02; Fold-change: -3.53E-01; Z-score: -1.17E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 4A43	Systemic autoimmune disease	Click to Show/Hide
The Studied Tissue	Salivary gland tissue
The Specified Disease	Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.16E-01; Fold-change: 1.18E-01; Z-score: 6.65E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.47E-02; Fold-change: -3.62E-01; Z-score: -1.76E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: 4A62	Behcet disease	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.44E-01; Fold-change: 1.65E-01; Z-score: 6.51E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 05	Endocrine/nutritional/metabolic disease	Click to Show/Hide
ICD-11: 5A11	Type 2 diabetes mellitus	Click to Show/Hide
The Studied Tissue	Omental adipose tissue
The Specified Disease	Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.56E-02; Fold-change: 5.09E-01; Z-score: 1.26E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Liver tissue
The Specified Disease	Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.80E-01; Fold-change: -8.06E-02; Z-score: -2.00E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5A80	Ovarian dysfunction	Click to Show/Hide
The Studied Tissue	Vastus lateralis muscle
The Specified Disease	Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.24E-01; Fold-change: 3.29E-02; Z-score: 2.14E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C51	Inborn carbohydrate metabolism disorder	Click to Show/Hide
The Studied Tissue	Biceps muscle
The Specified Disease	Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.46E-01; Fold-change: 2.82E-01; Z-score: 1.10E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 5C80	Hyperlipoproteinaemia	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.10E-01; Fold-change: 2.10E-02; Z-score: 9.20E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 06	Mental/behavioural/neurodevelopmental disorder	Click to Show/Hide
ICD-11: 6A20	Schizophrenia	Click to Show/Hide
The Studied Tissue	Prefrontal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.26E-02; Fold-change: 1.80E-01; Z-score: 2.82E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Superior temporal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.89E-01; Fold-change: -1.62E-02; Z-score: -7.49E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A60	Bipolar disorder	Click to Show/Hide
The Studied Tissue	Prefrontal cortex
The Specified Disease	Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.24E-02; Fold-change: 8.71E-02; Z-score: 5.92E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 6A70	Depressive disorder	Click to Show/Hide
The Studied Tissue	Hippocampus
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.89E-01; Fold-change: -1.17E-02; Z-score: -7.86E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 08	Nervous system disease	Click to Show/Hide
ICD-11: 8A00	Parkinsonism	Click to Show/Hide
The Studied Tissue	Substantia nigra tissue
The Specified Disease	Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.83E-01; Fold-change: 9.93E-03; Z-score: 2.54E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A20	Alzheimer disease	Click to Show/Hide
The Studied Tissue	Entorhinal cortex
The Specified Disease	Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.48E-03; Fold-change: 6.50E-02; Z-score: 2.42E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A2Y	Neurocognitive impairment	Click to Show/Hide
The Studied Tissue	White matter tissue
The Specified Disease	HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.91E-01; Fold-change: -6.48E-02; Z-score: -2.45E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8A40	Multiple sclerosis	Click to Show/Hide
The Studied Tissue	Plasmacytoid dendritic cells
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.48E-02; Fold-change: -4.65E-01; Z-score: -1.13E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
The Studied Tissue	Spinal cord
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.56E-01; Fold-change: 1.39E+00; Z-score: 1.02E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: 8A60	Epilepsy	Click to Show/Hide
The Studied Tissue	Peritumoral cortex tissue
The Specified Disease	Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 4.09E-01; Fold-change: -5.12E-01; Z-score: -8.40E-01
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
The Studied Tissue	Whole blood
The Specified Disease	Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.72E-02; Fold-change: -1.81E-01; Z-score: -8.01E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8B11	Cerebral ischaemic stroke	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.59E-01; Fold-change: 1.00E-02; Z-score: 4.01E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: 8C75	Distal myopathy	Click to Show/Hide
The Studied Tissue	Muscle tissue
The Specified Disease	Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.36E-05; Fold-change: 1.04E+00; Z-score: 1.80E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 11	Circulatory system disease	Click to Show/Hide
ICD-11: BA41	Myocardial infarction	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.28E-02; Fold-change: -1.69E-01; Z-score: -2.46E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 12	Respiratory system disease	Click to Show/Hide
ICD-11: CA08	Vasomotor or allergic rhinitis	Click to Show/Hide
The Studied Tissue	Peripheral blood
The Specified Disease	Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.60E-01; Fold-change: 6.75E-01; Z-score: 9.12E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CA23	Asthma	Click to Show/Hide
The Studied Tissue	Nasal and bronchial airway
The Specified Disease	Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.02E-04; Fold-change: 1.49E-01; Z-score: 1.50E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: CB03	Idiopathic interstitial pneumonitis	Click to Show/Hide
The Studied Tissue	Lung tissue
The Specified Disease	Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.72E-02; Fold-change: 4.73E-01; Z-score: 9.55E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 13	Digestive system disease	Click to Show/Hide
ICD-11: DA0C	Periodontal disease	Click to Show/Hide
The Studied Tissue	Gingival tissue
The Specified Disease	Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.14E-04; Fold-change: -2.04E-01; Z-score: -3.70E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: DA42	Gastritis	Click to Show/Hide
The Studied Tissue	Gastric antrum tissue
The Specified Disease	Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.30E-01; Fold-change: 3.44E-01; Z-score: 1.15E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section
ICD-11: DB92	Non-alcoholic fatty liver disease	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.85E-01; Fold-change: 7.58E-02; Z-score: 7.99E-02
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: DB99	Hepatic failure	Click to Show/Hide
The Studied Tissue	Liver tissue
The Specified Disease	Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.53E-04; Fold-change: -9.67E-01; Z-score: -2.29E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: DD71	Ulcerative colitis	Click to Show/Hide
The Studied Tissue	Colon mucosal tissue
The Specified Disease	Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.82E-04; Fold-change: -5.48E-01; Z-score: -1.21E+00
DME expression in the diseased tissue of patients DME expression in tissue other than the diseased tissue of patients
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of the other disease section
ICD Disease Classification 14	Skin disease	Click to Show/Hide
ICD-11: EA90	Psoriasis	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.91E-05; Fold-change: 1.23E-01; Z-score: 2.71E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 9.22E-55; Fold-change: 8.57E-01; Z-score: 3.00E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue adjacent to the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data of patients in the normal section of the tissue adjacent to the disease section Download DME expression data in the tissue of healthy individual
ICD-11: ED63	Acquired hypomelanotic disorder	Click to Show/Hide
The Studied Tissue	Skin
The Specified Disease	Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.14E-01; Fold-change: -1.23E-01; Z-score: -4.28E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 16	Genitourinary system disease	Click to Show/Hide
ICD-11: GC00	Cystitis	Click to Show/Hide
The Studied Tissue	Bladder tissue
The Specified Disease	Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.31E-02; Fold-change: -3.47E-01; Z-score: -1.23E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD Disease Classification 20	Developmental anomaly	Click to Show/Hide
ICD-11: LD2C	Overgrowth syndrome	Click to Show/Hide
The Studied Tissue	Adipose tissue
The Specified Disease	Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.47E-01; Fold-change: -3.94E-01; Z-score: -1.25E+00
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual
ICD-11: LD2D	Phakomatoses/hamartoneoplastic syndrome	Click to Show/Hide
The Studied Tissue	Perituberal tissue
The Specified Disease	Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.49E-01; Fold-change: -1.62E-01; Z-score: -7.29E-01
DME expression in the diseased tissue of patients DME expression in the normal tissue of healthy individuals
Violin Diagram of DME Disease-specific Protein Abundances		Click to View the Clearer Original Diagram
Download DME expression barchart for all samples Download DME expression data of patients in the disease section of the tissue Download DME expression data in the tissue of healthy individual

References
1	Initial characterization of human DHRS1 (SDR19C1), a member of the short-chain dehydrogenase/reductase superfamily. J Steroid Biochem Mol Biol. 2019 Jan;185:80-89.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.