Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1009) | |||||
|---|---|---|---|---|---|
| DME Name | Biphenyl dioxygenase (bphC), Pseudomonas furukawaii | ||||
| Synonyms | Biphenyl-2,3-diol 1,2-dioxygenase; 2,3-dihydroxybiphenyl dioxygenase; 23OHBP oxygenase; DHBD; bphC | ||||
| Gene Name | bphC | ||||
| UniProt ID | |||||
| EC Number | EC: 1.13.11.39 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Pseudomonas furukawaii (Click to Show/Hide the Complete Species Lineage) | ||||
| Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MSIRSLGYMGFAVSDVAAWRSFLTQKLGLMEAGTTDNGDLFRIDSRAWRIAVQQGEVDDL
AFAGYEVADAAGLAQMADKLKQAGIAVTTGDASLARRRGVTGLITFADPFGLPLEIYYGA SEVFEKPFLPGAAVSGFLTGEQGLGHFVRCVPDSDKALAFYTDVLGFQLSDVIDMKMGPD VTVPVYFLHCNERHHTLAIAAFPLPKRIHHFMLEVASLDDVGFAFDRVDADGLITSTLGR HTNDHMVSFYASTPSGVEVEYGWSARTVDRSWVVVRHDSPSMWGHKSVRDKALRATKHEQ QPE |
||||
| Function | This enzyme participates in the degradation pathway of biphenyl and PCB (poly chlorinated biphenyls) and contains Fe2+ or Mn2+ . | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs in Phase 4 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Isoflavone |
Drug Info | Phase 4 | Asthma | ICD11: CA23 | [1] |
| Drugs in Phase 2 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
AUS-131 |
Drug Info | Phase 2 | Prostatic hyperplasia | ICD11: GA90 | [1] |
| Drugs in Phase 1 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
BRN-0183227 |
Drug Info | Phase 1 | Acute coronary syndrome | ICD11: BA4Z | [1] |
| Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Flavone |
Drug Info | Investigative | Colon cancer | ICD11: 2B90 | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | Flavonoids biotransformation by bacterial non-heme dioxygenases, biphenyl and naphthalene dioxygenase. Appl Microbiol Biotechnol. 2011 Jul;91(2):219-28. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

