Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1040) | |||||
---|---|---|---|---|---|
DME Name | Molybdopterin-dependent enzyme (molD), Raoultella planticola | ||||
Synonyms | Molybdopterin-dependent oxidoreductase; Oxidoreductase molD; molD | ||||
Gene Name | molD | ||||
UniProt ID | |||||
EC Number | EC: 1.1.1.40 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Raoultella planticola (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MTLARLALSGDLVRPSRLTVPDLLRWPQHRVAVSFECATSGTQHHRFTGPRLYDVLADAG
PGFDPVRRKDRLRFLIAVTGTDGHHALLSWAEIDPDFADAPVLLGVSIDDTPLDAAGPQL VLPQDRCGARHISQITAIRVDGSYRCAPVEVAAVP |
||||
Function | This enzyme catalyzes the conversion of doxorubicin to 7-deoxydoxorubicinol and 7-deoxydoxorubicinolone via a reductive deglycosylation mechanism. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Doxorubicin |
Drug Info | Approved | Breast cancer | ICD11: 2C60 | [1] |
References | |||||
---|---|---|---|---|---|
1 | Transformation of the anticancer drug doxorubicin in the human gut microbiome. ACS Infect Dis. 2018 Jan 12;4(1):68-76. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.