Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1120) | |||||
|---|---|---|---|---|---|
| DME Name | Glutamate racemase (MurI), Aquifex pyrophilus | ||||
| Synonyms | D-glutamate racemase; MurI; murI; BAS0806; BAS4379; BcGR; BsGR; BsRacE; DapF; FnGR; GBAA_0847; GBAA_4717 | ||||
| Gene Name | murI | ||||
| UniProt ID | |||||
| EC Number | EC: 5.1.1.3 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Aquifex pyrophilus (Click to Show/Hide the Complete Species Lineage) | ||||
| Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MKIGIFDSGVGGLTVLKAIRNRYRKVDIVYLGDTARVPYGIRSKDTIIRYSLECAGFLKD
KGVDIIVVACNTASAYALERLKKEINVPVFGVIEPGVKEALKKSRNKKIGVIGTPATVKS GAYQRKLEEGGADVFAKACPLFVPLAEEGLLEGEITRKVVEHYLKEFKGKIDTLILGCTH YPLLKKEIKKFLGDVEVVDSSEALSLSLHNFIKDDGSSSLELFFTDLSPNLQFLIKLILG RDYPVKLAEGVFTH |
||||
| Structure | |||||
| Function | This enzyme is a pyridoxal-phosphate protein providing the (R)-glutamate required for cell wall biosynthesis and converting L- or D-glutamate to D- or L-glutamate, respectively, but not other amino acids such as alanine, aspartate, and glutamine. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
L-glutamine |
Drug Info | Approved | Sickle-cell anaemia | ICD11: 3A51 | [1] |
| Experimental Enzyme Kinetic Data of Drugs | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
L-glutamine |
Drug Info | Approved | Sickle-cell anaemia | Km = 3300 microM | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | Structural and functional analysis of two glutamate racemase isozymes from Bacillus anthracis and implications for inhibitor design. J Mol Biol. 2007 Aug 31;371(5):1219-37. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

