Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1145) | |||||
|---|---|---|---|---|---|
| DME Name | Beta-glucosidase (bglA), Streptococcus mutans | ||||
| Synonyms | Periplasmic beta-glucosidase; Glucan endo-1 3-beta-D-glucosidase; Beta-D-glucosidase; NCTC11567_00841; bglA | ||||
| Gene Name | bglA | ||||
| UniProt ID | |||||
| EC Number | EC: 3.2.1.21 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Streptococcus mutans (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MKQRKHRYQFPDGFLWGSSTSGPQSEGTVPGDGKGPSNWDYWFSIESAKFHHQIGPEKTS
TFYENYKGDIALLKETGHTIFRTSIQWSRLIPEGVGEVNPKAVTFYREVFQDIIAQGIKL IVNLYHFDLPYALQEKGGWENKATVWAYETYAKTCFELFGDLVNTWITFNEPIVPVECGY LGYYHYPCKVDAKAAVQVAYNTQLASSLAVKACHKLHPDHKISIVLNMTPAYPRSDAPED VKAARIAELFQTKSFLDPSVLGVYPAELVSILEEADLLPQYSADELEIIKNNTVDFLGVN YYQPLRVQAPSKSQQEGDPLILDIYFEPYDMPGKKVNPHRGWEIYEPGLYDIALNLKEHY GNIEWLVTENGMGVEGEEAFLADGQIQDDYRITFIEDHLIQLHKALGEGANCKGYLLWTF IDCWSWLNAYKNRYGLVALDLESQKRTIKKSGYWFKALSESNGFDK |
||||
| Function | This enzyme has wide specificity for beta-D-glucosides such as beta-D-galactosides, alpha-L-arabinosides, beta-D-xylosides, beta-D-fucosides. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs in Phase 3 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
SC-46553 |
Drug Info | Phase 3 | Cerebral stroke | ICD11: 8B11 | [1] |
| Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 2 Drugs | ||||
HY-N0040 |
Drug Info | Preclinical | Rotavirus gastroenteritis | ICD11: 1A22 | [1] |
Ginsenoside Rb1 |
Drug Info | Investigative | Obesity | ICD11: 5B81 | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | Constitutive beta-glucosidases hydrolyzing ginsenoside Rb1 and Rb2 from human intestinal bacteria. Biol Pharm Bull. 2000 Dec;23(12):1481-5. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

