Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1222) | |||||
|---|---|---|---|---|---|
| DME Name | Beta-lactamase (blaB), Empedobacter brevis | ||||
| Synonyms | Penicillinase; Cephalosporinase; Beta-lactam; Metallo-beta-lactamase; EBR-1 | ||||
| Gene Name | EBR-1 | ||||
| UniProt ID | |||||
| EC Number | EC: 3.5.2.6 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Empedobacter brevis (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MKKLFSLIALIGSFAFGQIKPIQIDPINNNLFVYQTFNSFNGVEYNANGMYLVTNKGIVL
FDVPWQKSQYQELNDMLQEKYNLPVIAVFATHSHDDRAGDLSFYNELNIPTYATSLTNSK LKKEGKATSKFEIELGKTYKFGNEKFVFEYFGEGHTSDNVVVWFPKYKVLNGGCLIKGAD AVNLGYTGEANVVEWPKTVHKLVAKHPTIKQVIPGHDNWKATGHIENTFKLLEKK |
||||
| Function | This enzyme hydrolyzes beta-lactam. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 2 Drugs | ||||
Penicillin G |
Drug Info | Approved | Diphtheria | ICD11: 1C17 | [1] |
Cephalosporin |
Drug Info | Approved | Pneumocystis pneumonia | ICD11: CA40 | [1] |
| Drugs in Phase 4 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Carbapenem |
Drug Info | Phase 4 | Infectious cystitis | ICD11: GC00 | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | EBR-1, a novel Ambler subclass B1 beta-lactamase from Empedobacter brevis. Antimicrob Agents Chemother. 2002 Oct;46(10):3223-7. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

