Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1228) | |||||
|---|---|---|---|---|---|
| DME Name | Beta-lactamase (blaB), Plesiomonas shigelloides | ||||
| Synonyms | Penicillinase; Cephalosporinase; Beta-lactam; pse4; NCTC10363_01512 | ||||
| Gene Name | pse4 | ||||
| UniProt ID | |||||
| EC Number | EC: 3.5.2.6 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Plesiomonas shigelloides (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MKVLGRTFFRAAAVVISCWSLAGLAQSSLVKEQDTAALSAQVKSVEQTLGARVGVSVFIP
SQGVVWNYHGDQRFPMMSTFKTLACAKMLSDVDAGKLALNDTVKVRSEDLMEYSPVLRPL AGTDITLQAACQATMETSDNTAANLVLEKIGGPAALTAYLQSIGDNVTRLDRNEPTLNEA AKHDPRDTTTPNAINHTLNTLVLGETLSSTSRQQLKTWMQDNKVADGLLRSVLPQGVQIA DRSGAGGFGSRGITALVWSAQQDPMFVSIYLTQTEATFDERNAAIVTIGKSIFDTFLTR |
||||
| Function | This enzyme hydrolyzes beta-lactam. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 2 Drugs | ||||
Ampicillin |
Drug Info | Approved | Endocarditis | ICD11: 1B12 | [1] |
Carbenicillin |
Drug Info | Approved | Infectious cystitis | ICD11: GC00 | [1], [2] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

