Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1294) | |||||
|---|---|---|---|---|---|
| DME Name | Rifampicin monooxygenase (rox), Nocardia farcinica | ||||
| Synonyms | Monooxygenase rifampicin; RIF-O; RIFMO; RifMO; rox; roxNFA_35380 | ||||
| Gene Name | rox | ||||
| UniProt ID | |||||
| EC Number | EC: 1.14.13.- (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Nocardia farcinica (Click to Show/Hide the Complete Species Lineage) | ||||
| Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human lung. | ||||
| Sequence |
MIDVIIAGGGPTGLMLAGELRLHGVRTVVLEKEPTPNQHSRSRGLHARSIEVMDQRGLLE
RFLAHGEQFRVGGFFAGLAAEWPADLDTAHSYVLAIPQVVTERLLTEHATELGAEIRRGC EVAGLDQDADGVTAELADGTRLRARYLVGCDGGRSTVRRLLGVDFPGEPTRVETLLADVR IDVPVETLTAVVAEVRKTQLRFGAVPAGDGFFRLIVPAQGLSADRAAPTLDELKRCLHAT AGTDFGVHSPRWLSRFGDATRLAERYRTGRVLLAGDAAHIHPPTGGQGLNLGIQDAFNLG WKLAAAIGGWAPPDLLDSYHDERHPVAAEVLDNTRAQMTLLSLDPGPRAVRRLMAELVEF PDVNRHLIEKITAIAVRYDLGDGHDLVGRRLRDIPLTEGRLYERMRGGRGLLLDRTGRLS VSGWSDRVDHLADPGAALDVPAALLRPDGHVAWVGEDQDDLLAHLPRWFGAAT |
||||
| Structure | |||||
| Function | This enzyme can modify rifampicin, thereby inactivating its antibiotic activity. And it constitutes a secondary rifampicin resistance factor. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Rifampicin |
Drug Info | Approved | Osteoporosis | ICD11: FB83 | [1] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

