Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1477) | |||||
|---|---|---|---|---|---|
| DME Name | Beta-glucosidase (bglA), Bacteroides dorei | ||||
| Synonyms | Periplasmic beta-glucosidase; Glucan endo-1 3-beta-D-glucosidase; Beta-D-glucosidase; BN702_00404 | ||||
| Gene Name | BN702_00404 | ||||
| UniProt ID | |||||
| EC Number | EC: 3.2.1.21 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Bacteroides dorei (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MHSKQKGTFPTTPRILAAFLMAFFLMVSCGCSTKIGQPVLPDSEGNGSETETPDDNKPDE
NKPGENEQTPDSEGYVLMWSDEFDSNSLDTGKWRIEVNGNGGGNAELQYYDESGISLGKD SEYGNSALKITAKREQRNGKAFVSGRLNTSGHFQFCYGKVEGRIRLPRTANGLWPAFWLL GADFQTNSWPRCGEIDIMEMGNAEGIKKGTQDRFFNGACHWGYYKGSAYPNYAHSTTNSY SIQDGNYHTYTLIWTPQSVKMYLDRDLHPNASPYYEMDIVNKDDDWGVGYYFHHNFFIIL NLAVGGYFTGILQPEGITALPNNGDSATMFVDWVRVYQKKQ |
||||
| Function | This enzyme has wide specificity for beta-D-glucosides such as beta-D-galactosides, alpha-L-arabinosides, beta-D-xylosides, beta-D-fucosides. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs in Phase 2 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
AS-35335 |
Drug Info | Phase 2/3 | Venous thromboembolism | ICD11: BD72 | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | Identification of rutin deglycosylated metabolites produced by human intestinal bacteria using UPLC-Q-TOF/MS. J Chromatogr B Analyt Technol Biomed Life Sci. 2012 Jun 1;898:95-100. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.