Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1563) | |||||
|---|---|---|---|---|---|
| DME Name | Beta-lactamase (blaB), Ralstonia pickettii | ||||
| Synonyms | Penicillinase; Cephalosporinase; Beta-lactam; bla OXA-60; blaOXA; blaOXA-60a; CJ026_005695 | ||||
| Gene Name | bla | ||||
| UniProt ID | |||||
| EC Number | EC: 3.5.2.6 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Ralstonia pickettii (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human oral cavity. | ||||
| Sequence |
MLSRYSKTLAFAVVACTLAISTATAHAELVVRNDLKRVFDDAGVSGTFVLMDITADRTYV
VDPARAARSIHPASTFKIPNSLIAFDTGAVRDDQEVLPYGGKPQPYEQWEHDMALPEAIR LSAVPIYQEVARRVGFERMQAYVDAFDYGNRQLGSAIDQFWLRGPLEISAFEEARFTSRM ALKQLPVKPRTWDMVQRMLLIEQQGDAALYAKTGVATEYQPEIGWWAGWVERAGHVYAFA LNIDMPREGDMAKRIPLGKQLMRALEVWPAP |
||||
| Function | This enzyme hydrolyzes beta-lactam. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Ampicillin |
Drug Info | Approved | Endocarditis | ICD11: 1B12 | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | Beta-lactamase production and antimicrobial susceptibility of subgingival bacteria from refractory periodontitis. Oral Microbiol Immunol. 2004 Oct;19(5):303-8. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

