Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1632) | |||||
|---|---|---|---|---|---|
| DME Name | Aminoglycoside adenylyltransferase (aadA1a), Salmonella enterica | ||||
| Synonyms | Streptomycin 3''-adenylyltransferase; Aminoglycosideadenylyl transferase; aadA; aadA1; aadA1a; ASQ14_26245; ASQ14_27545; FJR52_24735 | ||||
| Gene Name | aadA1a | ||||
| UniProt ID | |||||
| Gene ID | |||||
| EC Number | EC: 2.7.7.46 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Salmonella enterica (Click to Show/Hide the Complete Species Lineage) | ||||
| Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPHSDIDLLVTVTVRLDE
TTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAKRELQFGEWQRNDILAG IFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLFEALNETLTLWNSPPDWA GDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQPVILEARQAYLGQEEDRLA SRADQLEEFVHYVKGEITKVVGK |
||||
| Function | This enzyme can use ATP, dATP, CTP, ITP and GTP as donors and kanamycin, tobramycin and sisomicin as acceptors. And it mediates bacterial resistance to the antibiotics streptomycin and spectomycin. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 2 Drugs | ||||
Spectinomycin |
Drug Info | Approved | Gonococcal infection | ICD11: 1A70 | [1] |
Streptomycin |
Drug Info | Approved | Infectious endocarditis | ICD11: BB40 | [1] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Structural mechanism of AadA, a dual-specificity aminoglycoside adenylyltransferase from Salmonella enterica. J Biol Chem. 2018 Jul 20;293(29):11481-11490. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

